PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART12G17240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 332aa    MW: 35166.1 Da    PI: 8.4955
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART12G17240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32183238156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv a+++LGG++ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  OBART12G17240.1 183 KARRCWSPELHRRFVAALQRLGGPQAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 238
                      68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.583180240IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-29181241IPR009057Homeodomain-like
SuperFamilySSF466892.03E-17181241IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26183238IPR006447Myb domain, plants
PfamPF002492.5E-7185236IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEVFRRELPI SVHLIADVIE WLKDEVEKQR LLRRRQVEAP AAAPPPEMFA PPATAKRKSA  60
ASAAAEGVKA EADANDKRSW MSSAQLWSCG SHTSTSTSNG GSVKKQQHKV SNAFVPLATS  120
PAFAKSLEKA DAATPLPAAV PDLSLSSRVA MADAPAFPAA PSATSSAVTD VAGAQRQQAV  180
QRKARRCWSP ELHRRFVAAL QRLGGPQAAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR  240
RASDGGGGGG DHQTVGGGLW PPPPEQYTTS QHSTSQSGSP QGPLQLTVSS SHAVSVTAGD  300
SCDGGEEEEE EDGKSGSYSW EMQNGARASS SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-13183236255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-13183236255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13183236154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13183236154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13183236154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13183236154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-13183236255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-13183236255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-13183236255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-13183236255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-13183236255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-13183236255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126201e-158CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618787.11e-178transcription factor HHO6
TrEMBLI1R7H60.0I1R7H6_ORYGL; Uncharacterized protein
STRINGORGLA12G0148200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55823353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-29G2-like family protein