PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART12G16530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 645aa    MW: 71572.4 Da    PI: 5.6024
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART12G16530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.11.6e-1102656371374
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+ar+a+++s + ++l +++ts    ++ l+a++l+  +  + k+s
  OBART12G16530.1 265 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARIAGTGSLVHQSLVAKRTS---AVDILQAYQLYMAAICFKKVS 355
                      6789***************************************************999999999999998...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++  Nq+I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++R+Tg++ p++g   +e++eetg+rL+k+A+e+gvpf++n+++a ++
  OBART12G16530.1 356 FIFSNQTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVRMTGIDLPQPGfrPTERIEETGHRLSKYAQEFGVPFKYNAIAAVKM 449
                      **********************************************************9*****************************9999** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e+++ e+L+++p+E+l+Vn+++q ++l+desv ++s+rd vL+ +++++P+v++++  + + +++ F++rf eal +ysalfd l+a+ prese
  OBART12G16530.1 450 ESVRKEDLNIDPDEVLIVNCQYQFKNLMDESVVIDSPRDIVLSNIRKMQPHVFIHAIVNGSFSAPFFVTRFREALFFYSALFDVLDATTPRESE 543
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +r  +E+ ++gr++ nv+aceg +r+er et+++W+ r ++aGFk++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++S W+
  OBART12G16530.1 544 QRLLIEQNIFGRAALNVIACEGIDRVERPETYKQWQVRNQRAGFKQLPLNPEIVQVVRNKVKDCYHKDFVIDIDHQWLLQGWKGRILYAISTWT 637
                      *****************************************************************889*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.733239617IPR005202Transcription factor GRAS
PfamPF035145.4E-108265637IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MGSSAADSFP AGGDDAIRDV YGIGGGGEED DPSLFLYLSD LAPVSPSAYL DLPPSPPPPT  60
TTATTMVKEG EEAPEDLVLP FISRMLMEED IDDNSAFLKG MEEANKFLPT ENKLVIDLEA  120
SSENNYLRGL EEAKRFLPSD DKLQVGFAAA AAPVVSVKKE AVDVVVATAS GGGGRGRKNP  180
YDDEELELEG GRSSKQTAVQ GDDVAARAMF DKVMMPSHEN CTEMMEKLRI AMKEEAAKNE  240
ASAGGKGGNG KVKGGRRGGR DVVDLRTLLI HCAQAVATDD RRSATELLKQ IKQHAKPTGD  300
ATQRLAHCFA EGLQARIAGT GSLVHQSLVA KRTSAVDILQ AYQLYMAAIC FKKVSFIFSN  360
QTIYNASLGK KKIHIVDYGI QYGFQWPCFL RRISQREGGP PEVRMTGIDL PQPGFRPTER  420
IEETGHRLSK YAQEFGVPFK YNAIAAVKME SVRKEDLNID PDEVLIVNCQ YQFKNLMDES  480
VVIDSPRDIV LSNIRKMQPH VFIHAIVNGS FSAPFFVTRF REALFFYSAL FDVLDATTPR  540
ESEQRLLIEQ NIFGRAALNV IACEGIDRVE RPETYKQWQV RNQRAGFKQL PLNPEIVQVV  600
RNKVKDCYHK DFVIDIDHQW LLQGWKGRIL YAISTWTPND ALSYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-452696368374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448780.0AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724250.0AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1219430.0AK121943.1 Oryza sativa Japonica Group cDNA clone:J033107F03, full insert sequence.
GenBankAK1115220.0AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0D3HVY80.0A0A0D3HVY8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA037646-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-165GRAS family protein