PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART12G05930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 282aa    MW: 31968.1 Da    PI: 10.393
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART12G05930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.41.2e-251058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   rqvtf+kRr g+lKKA ELSvLCda+v viifss+gkl+e +
  OBART12G05930.1 10 RIENPVHRQVTFCKRRGGLLKKARELSVLCDADVGVIIFSSQGKLHELA 58
                     8*********************************************965 PP

2K-box47.76.7e-178116417100
            K-box  17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       +q +  L++ei+ Lqr +R   G + ++++l  L+ Le+ Le  + +iR++K++++ ++i+ l++ke  l+e+n++L++k +e
  OBART12G05930.1  81 AEQGIFLLREEIDLLQRGLRSTYGGGAGEMTLDKLHALEKGLELWIYQIRTTKMQMMQQEIQFLRNKEGILKEANEMLQEKSQE 164
                      56667789************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.4E-36160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-25164IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.464161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-26323IPR002100Transcription factor, MADS-box
CDDcd002653.42E-34364No hitNo description
PfamPF003191.1E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.14478168IPR002487Transcription factor, K-box
PfamPF014865.1E-1881162IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MVRGKVQMRR IENPVHRQVT FCKRRGGLLK KARELSVLCD ADVGVIIFSS QGKLHELATN  60
GYQSNVAGGQ MEPGALQRQV AEQGIFLLRE EIDLLQRGLR STYGGGAGEM TLDKLHALEK  120
GLELWIYQIR TTKMQMMQQE IQFLRNKEGI LKEANEMLQE KSQESDEDEE EERGDERVLD  180
GGGEYGERDE RQLQQQRRAG PGERGRQRHR RRVRWLRGQQ LPPPISDSAG SDGPFRRFSS  240
PSSAGGPPSP SPSPPPFAAR ATARRRRWRG RRVEGDVGIR EM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203213RGRQRHRRRVR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0713130.0AK071313.1 Oryza sativa Japonica Group cDNA clone:J023084A11, full insert sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0005600.0BX000560.1 Oryza sativa chromosome 12, . BAC OSJNBa0021D06 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX6492180.0BX649218.2 Oryza sativa chromosome 12, . BAC B1280F04 of chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878024.11e-110MADS-box transcription factor 33 isoform X4
SwissprotQ2QW551e-109MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A0D3HSH00.0A0A0D3HSH0_9ORYZ; Uncharacterized protein
STRINGOBART12G05930.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-51AGAMOUS-like 12