PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART12G00580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 116aa    MW: 12587.6 Da    PI: 10.2251
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART12G00580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP82.98.2e-261670359
              TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpai 59
                     g k +hsk+ T++g+RdRRvRls++ a+ f+d+qd+LG+d++sk+ieWL+++a  ai
  OBART12G00580.1 16 GEKGKHSKVVTSQGLRDRRVRLSVPMAIVFYDIQDRLGVDQPSKAIEWLIRAA--AI 70
                     6799**********************************************987..45 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136923.3391775IPR017887Transcription factor TCP subgroup
PfamPF036341.0E-251786IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MAAAWRTSRV AHVVVGEKGK HSKVVTSQGL RDRRVRLSVP MAIVFYDIQD RLGVDQPSKA  60
IEWLIRAAAI NALLSLDCSL VLPNAAQLLR AGRPPHPPYP ALSPVERGGG EVEADM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A8e-192266145Putative transcription factor PCF6
5zkt_B8e-192266145Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3'. {ECO:0000269|PubMed:12000681}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149683e-99AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0005103e-99BX000510.1 Oryza sativa chromosome 12, . BAC OJ1769_D07 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619107.19e-46transcription factor PCF8-like
SwissprotA2ZMR91e-35PCF8_ORYSI; Transcription factor PCF8
TrEMBLA0A0D3HQL04e-78A0A0D3HQL0_9ORYZ; Uncharacterized protein
STRINGOBART12G00580.17e-79(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115532638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30210.25e-24TCP family protein