PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART12G00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 313aa    MW: 34490.1 Da    PI: 8.179
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART12G00180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.52e-3057110255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtpeLH +Fv+av++LGG+++AtPk +l+lm+v gL++ h+kSHLQ+YR+
  OBART12G00180.1  57 PRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHIKSHLQMYRS 110
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.01853113IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2853111IPR009057Homeodomain-like
SuperFamilySSF466895.02E-1554111IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2256112IPR006447Myb domain, plants
PfamPF002491.2E-858109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MEKTSAGKEE GSESKTAAAN NDGSSTSSTT EEEESGESQR RTSSSSSVRP YIRSKNPRLR  60
WTPELHLSFV RAVDRLGGQD RATPKLVLQL MNVRGLSIGH IKSHLQMYRS KKIDESGQVI  120
GGGSWRSSDE QQYRHLQMQG GGDGGQAYNL GHLSLPAALH HRHITAGSGT ILQSRVANAW  180
SPWRCHGSYW LRAGHHLLVG SKPYYPPPPA EARANTSSNH PDFVQGSSSS PDDHTMNHQR  240
PVVLKEMIYN EGSNHQGGPL NLDLSLDICP RGDKRKREFS WRKHEEDHDH TTIAIGGDQE  300
AESCATGLSL SLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1758112357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1758112357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1758112357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1758112357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1072970.0AK107297.1 Oryza sativa Japonica Group cDNA clone:002-126-C05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620339.10.0probable transcription factor RL9
TrEMBLA0A0D3HQE90.0A0A0D3HQE9_9ORYZ; Uncharacterized protein
TrEMBLI1R3A30.0I1R3A3_ORYGL; Uncharacterized protein
STRINGORGLA12G0000900.10.0(Oryza glaberrima)
STRINGOBART12G00180.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-38G2-like family protein