PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART11G23680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 642aa    MW: 72098.6 Da    PI: 6.5811
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART11G23680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.51e-1062646382373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       +lLl+cA+av+++d + a++lL ++++++s  gd+ qRla++f+++L+arla+++s++y++l +++ts   +++ l+a++l+ e++ + k+++
  OBART11G23680.1 264 HNLLLHCAQAVATDDRRSAHELLRQIKQHSSAWGDAGQRLAHCFAQGLEARLAGTGSQVYQSLMSQRTS---VVDFLKAYRLYMEACCCKKVAF 354
                      689************************************************************999999...********************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      +  N++I++av+g +++Hi+D+++s+G+QWp Ll++La+R++gpp++RiTg++ p++g    + +eetg+rL+++A+elgvpf+f+ ++a++ e
  OBART11G23680.1 355 VFSNKTIYDAVAGRRKLHIVDYGLSYGFQWPGLLRELAARRGGPPEVRITGIDLPQPGfrPDQHIEETGRRLSRYADELGVPFKFHGIAATKKE 448
                      *********************************************************9*99***************************999*** PP

             GRAS 188 dleleeLrvkp.gEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                      +++leeL   + +E+++V +  +  +++des++ +s   +rdevL  +++++P+v+++   +  ++++ Fl+rf eal+yy+a fd l+a+++r
  OBART11G23680.1 449 SVRLEELGEAEeDEVVVVISLCHFRNVMDESLQEDSsrsPRDEVLGNIRRMRPDVFIHGIMNGAYGATYFLTRFREALYYYAAQFDLLDATVGR 542
                      *******77766******************9988777779****************************************************** PP

             GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                      es+er+ vEr ++gr++ nv+acegaer+er e +++W++r ++aG++++pl+ +++  +   +r  + + + v+e++ +l+  Wk+r L+++S
  OBART11G23680.1 543 ESHERMLVERDIFGRAALNVIACEGAERVERPEMYKQWQARNQRAGLRQLPLNPQVVRLVLDKVRDKYHKDFVVDEDQRWLLHRWKGRVLYALS 636
                      **************************************************************999999888*********************** PP

             GRAS 372 aW 373
                       W
  OBART11G23680.1 637 TW 638
                      ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.097237619IPR005202Transcription factor GRAS
PfamPF035143.6E-104264638IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MATTPEAEES LRFRWPAAEE EFDNDMVLPY ISRLLMEDDV HDHFFYQYPD HPALLRAQQP  60
FAQILASSPS SAAGASSSSS SSDAPPSRPF FDDEAATAKT FPTAAVHSVD HQYSGGLDMV  120
NMAFLKGMEE ANKFLPTNTL LLSTDSSTTL QLQVQGEVVV DGHGMLGGVG GAAAAHAHGA  180
INSKKVNCRD DDLEAGTGRA TKLMAPEPEL EEEGARQMFD EMMLQEHEIC MKGVKQLSLK  240
SKSSSSKKAR GRRTVIHTEP VDLHNLLLHC AQAVATDDRR SAHELLRQIK QHSSAWGDAG  300
QRLAHCFAQG LEARLAGTGS QVYQSLMSQR TSVVDFLKAY RLYMEACCCK KVAFVFSNKT  360
IYDAVAGRRK LHIVDYGLSY GFQWPGLLRE LAARRGGPPE VRITGIDLPQ PGFRPDQHIE  420
ETGRRLSRYA DELGVPFKFH GIAATKKESV RLEELGEAEE DEVVVVISLC HFRNVMDESL  480
QEDSSRSPRD EVLGNIRRMR PDVFIHGIMN GAYGATYFLT RFREALYYYA AQFDLLDATV  540
GRESHERMLV ERDIFGRAAL NVIACEGAER VERPEMYKQW QARNQRAGLR QLPLNPQVVR  600
LVLDKVRDKY HKDFVVDEDQ RWLLHRWKGR VLYALSTWVA QH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-392676388374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616926.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A0D3HQ940.0A0A0D3HQ94_9ORYZ; Uncharacterized protein
STRINGORGLA11G0190400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-134GRAS family protein