PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART11G23660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 446aa    MW: 51223.3 Da    PI: 4.6917
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART11G23660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS281.82e-8612643673373
             GRAS  73 nsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetger 164
                      ++++ l+a+klf  ++ i k+s++  N++Il+av+g++++Hi+D+++s+G+QWp L++ L++R++gpp++RiTg++ p++g   ++++eetg+r
  OBART11G23660.1 126 STVDFLKAYKLFAAACCIKKVSFIFSNKTILDAVAGKRKLHIVDYGLSYGFQWPGLFKCLSEREGGPPEVRITGIDFPQPGfrPADQIEETGRR 219
                      38899***************************************************************************9************* PP

             GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkp.......gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhn 249
                      L++ A+++gvpf+f++ +a ++e+++ e+L++++       +E+l+Vn+ + l  l desv ++s  +rd vL+ +++++P+v+v +  +  ++
  OBART11G23660.1 220 LSNCARQFGVPFRFQA-IAAKWETVRREDLHLDReeeeeeeEEVLVVNCLHFLNALQDESVVVDSpsPRDMVLNNIRDMRPHVFVQCVVNGAYG 312
                      ****************.799**********9999999999999*****************98888779************************** PP

             GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                      ++ Fl+rf e+l +ys+ fd+l+a++pr+++er  +Er +lgr++ nv+acega+r+ r et+++W  r ++aG++++pl+ ++++ ++  ++k
  OBART11G23660.1 313 APFFLTRFRETLFFYSSQFDMLDATIPRDNDERLLIERDILGRWALNVIACEGADRVDRPETYKQWLVRNHRAGLTQLPLQPQVVELVRDKVKK 406
                      ********************************************************************************************** PP

             GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       + + + ++ ++++l++gWk+r L+++S W
  OBART11G23660.1 407 LYHKDFVIDVDHNWLLQGWKGRILYAMSTW 436
                      **888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.8141417IPR005202Transcription factor GRAS
PfamPF035147.0E-84126436IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MAAAAPQLEE LVDLEPFSPS LFLDLPPTPH GDDPNDDDLI LPFISRMLME DDIDDKFFYQ  60
FPDHPALLHA QQPYAQILDA PSDDTTTNSS DDSKDLKLLF SAADNMEMLN MAFLKGREEA  120
NKLCTSTVDF LKAYKLFAAA CCIKKVSFIF SNKTILDAVA GKRKLHIVDY GLSYGFQWPG  180
LFKCLSEREG GPPEVRITGI DFPQPGFRPA DQIEETGRRL SNCARQFGVP FRFQAIAAKW  240
ETVRREDLHL DREEEEEEEE EVLVVNCLHF LNALQDESVV VDSPSPRDMV LNNIRDMRPH  300
VFVQCVVNGA YGAPFFLTRF RETLFFYSSQ FDMLDATIPR DNDERLLIER DILGRWALNV  360
IACEGADRVD RPETYKQWLV RNHRAGLTQL PLQPQVVELV RDKVKKLYHK DFVIDVDHNW  420
LLQGWKGRIL YAMSTWVADR DHKSLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2913443680374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAK1021990.0AK102199.1 Oryza sativa Japonica Group cDNA clone:J033087D22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617900.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809331e-113SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0D3HQ920.0A0A0D3HQ92_9ORYZ; Uncharacterized protein
STRINGORGLA11G0190200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-104GRAS family protein