PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART11G00370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 872aa    MW: 94720.2 Da    PI: 7.4041
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART11G00370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like962.9e-30612665255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtpeLH +Fv+av++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  OBART11G00370.1 612 PRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 665
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF011035.0E-21177488IPR000184Bacterial surface antigen (D15)
PROSITE profilePS5129411.92608668IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-28608666IPR009057Homeodomain-like
SuperFamilySSF466891.4E-14609666IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-22611667IPR006447Myb domain, plants
PfamPF002494.9E-8613664IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0019867Cellular Componentouter membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 872 aa     Download sequence    Send to blast
MATASSPASV QDYPDLQEDD DDDFQDDDDL DDEDKEDDDD QEPSPSPSDE ARLQSVLRRL  60
TAEEVRIRVH DVEIRGCCRT RRAAVEAAVG SDLPRAATVR DLVRAAAAAA DRIRRLGAFD  120
TVSITLDAAP PGIPGNAAVI VLVDVAEARG RAAGELGIFA NKGTRSCSVQ GSVKLKNLFG  180
YCETWDASGD LGLDQTVELS TGVAIPRIGA IPTPLVARIS FLSEDWLKSS LREHMMGVSV  240
GLLSTMNHNL AYNLSWRTIT DRALMSSNSI RGQLGHSLLS SIKYAYKVDQ RDSRIRPTRG  300
YAYLFSSQVG GLAPESKDAR YIRQELDLRV ALPLGVLNGA LNAGVAAGII HPLARGSTGS  360
ISPLSEQFYL GGNRSLMCRL GGPSSLLGFK KRGLGTDLQS STPENSENVA STSPELSARG  420
GDIAVTAFAD LSFDIPLKPL RELGIHGHAF VSAGNLAKLT EPDLRKFPLA EFLQTFRSSA  480
GFGVVVPTRL FRIEVLKKSS NVFLQVQVRQ PATMFDKPPN SVIQLFKRCS RISSNKTTRV  540
HHQAKLAKAI ESWPAGKEEE EEDGGGGAPA AAANNYGSST TSSTTEEEGS GESRRRTSSS  600
SSVRPYVRSK NPRLRWTPEL HLSFVRAVDR LGGQDRATPK LVLQLMNVRG LSIGHVKSHL  660
QMYRSKKIDE SGQVIGGESW RSDDHLQMQG GGHGGQAYNL GHLSLPALHH RSITAGSGTI  720
FQSRFGNLWS PWRCHGSYWL PAGHHLLVGS KPYYPPAAEA EAPFRRSSSR YVARANTSNH  780
PDFVQGSSSS PDDHIMNHQR PVLKEMICSE GSNHQEGPLN LDLSLDICPR GEKRKRECSW  840
RKKEEDHDHA TVAIGGDQEA ESCATGLSLS LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A8e-18613667357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-18613667357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-18613667357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-18613667357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0666500.0AK066650.1 Oryza sativa Japonica Group cDNA clone:J013071M22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617112.10.0uncharacterized protein LOC4349555
RefseqXP_015617113.10.0uncharacterized protein LOC4349555
RefseqXP_015617114.10.0uncharacterized protein LOC4349555
RefseqXP_025877044.10.0uncharacterized protein LOC4349555
RefseqXP_025877045.10.0uncharacterized protein LOC4349555
TrEMBLA0A0D3HH710.0A0A0D3HH71_9ORYZ; Uncharacterized protein
STRINGOBART11G00370.10.0(Oryza barthii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.16e-36G2-like family protein