PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART10G17270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 329aa    MW: 36122.5 Da    PI: 8.3503
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART10G17270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-311972255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ+YR 
  OBART10G17270.1 19 PRLRWTPDLHHCFVHAIHKLGGQHKATPKRVLQLMGVGGLTISHVKSHLQMYRN 72
                     8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8941575IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-301574IPR009057Homeodomain-like
SuperFamilySSF466891.79E-151773IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-241972IPR006447Myb domain, plants
PfamPF002496.0E-102071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MVRRERIEGV RQYNRSKVPR LRWTPDLHHC FVHAIHKLGG QHKATPKRVL QLMGVGGLTI  60
SHVKSHLQMY RNMRNDDLGM QGIQQMDDQE QTFAGGMQIW TDMQLQDHHH ECNGPYCRCH  120
SSSKHAKGSL LLLHHHQQQQ QLQRPNEMET RRAEASTQTG FLRSQGICER DVSSGLPVPA  180
AYYSYYTPMA HGAPPAAADG AGHDDPPRLL GLVVMATTTR RGSREEHKAT PPPENGAIRH  240
GRKARRTTAA AEEEERDGDG DELSLSLTLD SGLSCRSSGG AGAYCCSEGS SSNWLISSPS  300
STTSLVAGGC SRRSTPAMLS SVVSLDLSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126181e-177CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025876554.10.0uncharacterized protein LOC112936623 isoform X1
TrEMBLA0A0D3HG590.0A0A0D3HG59_9ORYZ; Uncharacterized protein
TrEMBLI1QVJ50.0I1QVJ5_ORYGL; Uncharacterized protein
STRINGORGLA10G0122800.10.0(Oryza glaberrima)
STRINGOBART10G17270.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76102950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-29G2-like family protein