PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART10G15720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Trihelix
Protein Properties Length: 318aa    MW: 33212.1 Da    PI: 4.731
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART10G15720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix101.85.3e-3295179187
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                      rW++qe+laL+++r++m++++r++ lk+plWeevs+k++e+g++rs+k+Ckek+en++k+yk++ke++ +r  ++ +t+++f+qlea
  OBART10G15720.1  95 RWPRQETLALLKIRSDMDSAFRDATLKGPLWEEVSRKLAEEGYRRSAKKCKEKFENVHKYYKRTKESRAGR--NDGKTYRFFTQLEA 179
                      8********************************************************************97..56668*******85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.004792154IPR001005SANT/Myb domain
PfamPF138374.6E-2294180No hitNo description
PROSITE profilePS500906.73794152IPR017877Myb-like domain
CDDcd122035.52E-3094159No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MQQQQPGGGG GGVQQFGAVA PEMSPFSPAG GGGGGRISMA EAASPISSRP PPAQQQFDEL  60
GVGGGGGGGG GFDAEALAAA AVGEEGASGG AGGNRWPRQE TLALLKIRSD MDSAFRDATL  120
KGPLWEEVSR KLAEEGYRRS AKKCKEKFEN VHKYYKRTKE SRAGRNDGKT YRFFTQLEAL  180
HGTAAGGVAA PSPPEDIMKE MMEQRPQQPA AANNAFNRTD GGGGGGGVDS DNMDEDDEDD  240
YDDDDDDDDV DGNKMQYEIQ FQHQHHHQQP PQHRHQQSVV RPNAAASAAA GGNPPGTAAP  300
ATAAAATTTT GSFLAMVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0252960.0AC025296.10 Oryza sativa chromosome 10 BAC OSJNBa0076F20 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698336.14e-75PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor GTL1
TrEMBLA0A0D3HFM30.0A0A0D3HFM3_9ORYZ; Uncharacterized protein
STRINGBGIOSGA031553-PA7e-91(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.12e-45GT-2-like 1