PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART10G12450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 253aa    MW: 28856.5 Da    PI: 7.0172
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART10G12450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.36.3e-27110163155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k rl Wt++LH++F+ av++L G++kA+Pk+il +mkvk Lt+e+v+SHLQkYR+
  OBART10G12450.1 110 KSRLTWTTQLHRQFIAAVNHL-GEDKAVPKKILGIMKVKHLTREQVASHLQKYRM 163
                      68*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23004.4E-8149No hitNo description
PROSITE profilePS5011012.963139IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521721.66E-6356IPR011006CheY-like superfamily
PROSITE profilePS5129412.473107166IPR017930Myb domain
SuperFamilySSF466896.45E-19108167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-26109167IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-24110163IPR006447Myb domain, plants
PfamPF002492.7E-7112162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MASSGDTNTV MKYVANGASD FLLKPVRIEE LSNIWQHIFR KQMQDHKNNN MVGNLEKPGH  60
PPSILAMARA TPATTKSTAT EALLAPLENE VRDDMVNYNG EITDIRDLRK SRLTWTTQLH  120
RQFIAAVNHL GEDKAVPKKI LGIMKVKHLT REQVASHLQK YRMQLKKSIP TTSKHGATLS  180
STALDKTQDH PSRSQYFNQD GCMEIMDYSL PRDDLSSGSE CMLEEQNDYS SEGFQDFRWD  240
SDKQEYGPCF WNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-18109167462ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that acts as floral inducer to promote short-day (SD) flowering pathway. Activates Hd3a and other FT-like genes independently from Hd1. May also activate MADS-box transcription factors involved in flowering regulation. {ECO:0000269|PubMed:15078816}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Daily oscillation and diurnal expression in plants grown in short day (SD) but not in long day (LD) conditions. {ECO:0000269|PubMed:15078816}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0925090.0AB092509.1 Oryza glaberrima Ehd1 gene for B-type response regulator, complete cds.
GenBankJN4021770.0JN402177.1 Oryza barthii isolate H21 B-type response regulator (Ehd1) gene, partial cds.
GenBankKC6092470.0KC609247.1 Oryza barthii early heading date 1 (Ehd1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025876814.10.0two-component response regulator ORR30
SwissprotQ7Y0W30.0EHD1_ORYSI; Two-component response regulator EHD1
TrEMBLA0A0D3HEF50.0A0A0D3HEF5_9ORYZ; Uncharacterized protein
STRINGOBART10G12450.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112222741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-33response regulator 2