PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART10G08140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 200aa    MW: 21168.8 Da    PI: 4.5786
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART10G08140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.91.5e-173687354
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54
                     k++++ +eq+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa 
  OBART10G08140.1 36 KKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRAS 87
                     4557899*******************************************95 PP

2HD-ZIP_I/II82.65.9e-273587153
      HD-ZIP_I/II  1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRAR 53
                     ekkrrl++eqv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRA 
  OBART10G08140.1 35 EKKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRAS 87
                     69*************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-172385IPR009057Homeodomain-like
SuperFamilySSF466892.92E-152886IPR009057Homeodomain-like
PROSITE profilePS5007114.6253191IPR001356Homeobox domain
SMARTSM003893.9E-153495IPR001356Homeobox domain
PfamPF000466.4E-153687IPR001356Homeobox domain
CDDcd000862.35E-153686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MRSYMDGGGA AAYEEEEEEV EDDDGGGGGG GGLGEKKRRL AAEQVRALER SFEADNKLDP  60
ERKARIARDL RLHPRQVAVW FQNRRASKVV DGSTDSDSSA VFNEEASPYS GAAIDHHHHQ  120
TPASYDTAGF TSFFAPSTTL TSSLSFPSMF HASSHFDGHQ ELLVGGGGAG AVADADLGGA  180
GFFAGDEHAG GLSWYGAEGW
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8377330.0CT837733.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA016M03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613231.18e-65homeobox-leucine zipper protein HOX8
SwissprotQ338Z77e-66HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A0D3HD241e-141A0A0D3HD24_9ORYZ; Uncharacterized protein
STRINGOBART10G08140.11e-142(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.25e-21homeobox protein 5
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]