PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART10G00650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BBR-BPC
Protein Properties Length: 282aa    MW: 30814.6 Da    PI: 10.3377
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART10G00650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind38.73.5e-124110986
        GAGA_bind   9 rnkg.yyepaaslkenlglqlmssia.erdakirernlalsekkaavaerd.............................maflqrdkalaern 71 
                      r +g +yep    ++nlglqlmss++ +rd+k+  + +  + + +a+++r+                             m+f+++d++++ ++
  OBART10G00650.1   4 RGWGaFYEPP---ARNLGLQLMSSVPaDRDTKQLLSVACPAPPPSAHHPREcgananananandgampppaateappsmlMNFVRNDMWMHPQQ 94 
                      88999***99...88**********99******7777778888888888888888888888888999************************966 PP

        GAGA_bind  72 k.alverdnkllalll 86 
                      + ++++r+ k+++ ++
  OBART10G00650.1  95 QhHHHPREPKMMQHQP 110
                      5166789999999887 PP

2GAGA_bind218.94.6e-67105273107275
        GAGA_bind 107 sidslqqlsepqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesad.erskaekksidlvl 198
                      ++++  +  +pq ++++ +  ++ee+++ + +ee++++++e + +kkrq++++pk+++ kk+kk +++++++ +++sa+ +r++ + k+i++v+
  OBART10G00650.1 105 MMQHQPE-PQPQPQPPPSPpHPKEECISPPLMEENVPVISEPPPPKKRQQGRQPKVPRPKKPKK-PAAPREDGAPPSAPaPRRRGPMKNIGMVI 196
                      3443333.44777777777799******************************************.9999********999************** PP

        GAGA_bind 199 ngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaae 275
                      ng++lD s++P+P+CsCtGa++qCY+WG+GGWqSaCCttt+S+yPLP+stkr gaRia rKm +gafkk+LekLa+e
  OBART10G00650.1 197 NGIDLDLSRIPTPICSCTGAPQQCYRWGAGGWQSACCTTTVSTYPLPMSTKRHGARIASRKMNHGAFKKVLEKLAGE 273
                      ***************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012267.3E-1171277IPR010409GAGA-binding transcriptional activator
PfamPF062171.9E-833274IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGLRGWGAFY EPPARNLGLQ LMSSVPADRD TKQLLSVACP APPPSAHHPR ECGANANANA  60
NANDGAMPPP AATEAPPSML MNFVRNDMWM HPQQQHHHHP REPKMMQHQP EPQPQPQPPP  120
SPPHPKEECI SPPLMEENVP VISEPPPPKK RQQGRQPKVP RPKKPKKPAA PREDGAPPSA  180
PAPRRRGPMK NIGMVINGID LDLSRIPTPI CSCTGAPQQC YRWGAGGWQS ACCTTTVSTY  240
PLPMSTKRHG ARIASRKMNH GAFKKVLEKL AGEATILIIR LT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}.
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0788910.0AC078891.2 Oryza sativa Japonica Group chromosome 10 clone OSJNBa0092N12, complete sequence.
GenBankAC1451270.0AC145127.1 Oryza sativa Japonica Group chromosome 10 clone Pseudo10p0.0-10p4.4, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankAY5705200.0AY570520.1 Oryza sativa (japonica cultivar-group) barley B recombinant like protein C gene, complete cds.
GenBankAY5705210.0AY570521.1 Oryza sativa (japonica cultivar-group) barley B recombinant like protein C mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025876706.11e-113barley B recombinant-like protein A isoform X2
RefseqXP_025876708.11e-113barley B recombinant-like protein B isoform X2
SwissprotP0DH881e-111BBRA_ORYSJ; Barley B recombinant-like protein A
SwissprotP0DH891e-111BBRB_ORYSJ; Barley B recombinant-like protein B
TrEMBLA0A0D3HAK70.0A0A0D3HAK7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA032378-PA1e-109(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.26e-41basic pentacysteine1
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]