PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART10G00630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BBR-BPC
Protein Properties Length: 342aa    MW: 37884.4 Da    PI: 10.2984
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART10G00630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind406.43.6e-12413421301
        GAGA_bind   1 mdddgsre.rnkg.yyepaaslkenlglqlmssia.erdaki...........rernlalsekkaavaerd....................... 57 
                      mddd+s++ r +g ++e+    ++nlglqlmss++ +rd+k+           +++++  +++++++++rd                       
  OBART10G00630.1   1 MDDDASMSiR-WGgFFESP---ARNLGLQLMSSVPaDRDTKQllsgspflhhqHQQQHVPHHHHQPHHPRDcgangnanggamppppateapps 90 
                      9*******66.777***99...88**********99***************99777777*********************************** PP

        GAGA_bind  58 ..maflqrdkalae..rnkalverdnkllalllvensla...salpvgvqvlsgtksidslqqlsepqledsave.lreeeklealpieeaaee 143
                        m+f+++d++++   +++++ +r++k+l++l+v ++++   +++pvg+++++gt++++++qq++epq ++++ + +++ee+++++ iee++++
  OBART10G00630.1  91 mpMNFVRSDMWMHPqqQQQHHXPREHKVLHNLTVGHGSShiaHHDPVGYGMIPGTHTLQMMQQQTEPQPQPPPXPxQPKEECISSPLIEENVPV 184
                      ************9754678999**************9988999*******************************999***************** PP

        GAGA_bind 144 akekkkkkkrqrakkpkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCt 236
                      ++e + +kkrq++++pk+++akk+kk s++++++ ++++a+ +r++ ++k+i++v+ng++lD s++P+PvCsCtGa++qCY+WG+GGWqSaCCt
  OBART10G00630.1 185 IDEPPPPKKRQQGRQPKVPRAKKPKK-SAAPREDGAPPNAPaPRRRGPRKNIGMVINGIDLDLSRIPTPVCSCTGAPQQCYRWGAGGWQSACCT 277
                      **************************.88999*******999**************************************************** PP

        GAGA_bind 237 ttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      ttiS+yPLP+stkrrgaRiagrKmS+gafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  OBART10G00630.1 278 TTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 342
                      ****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062172.4E-1181342IPR010409GAGA-binding transcriptional activator
SMARTSM012268.9E-2001342IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDDDASMSIR WGGFFESPAR NLGLQLMSSV PADRDTKQLL SGSPFLHHQH QQQHVPHHHH  60
QPHHPRDCGA NGNANGGAMP PPPATEAPPS MPMNFVRSDM WMHPQQQQQH HXPREHKVLH  120
NLTVGHGSSH IAHHDPVGYG MIPGTHTLQM MQQQTEPQPQ PPPXPXQPKE ECISSPLIEE  180
NVPVIDEPPP PKKRQQGRQP KVPRAKKPKK SAAPREDGAP PNAPAPRRRG PRKNIGMVIN  240
GIDLDLSRIP TPVCSCTGAP QQCYRWGAGG WQSACCTTTI STYPLPMSTK RRGARIAGRK  300
MSHGAFKKVL EKLAGEGYNL NNPIDLKTFW AKHGTNKFVT IR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612725.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612727.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612730.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612731.10.0PREDICTED: barley B recombinant-like protein A
SwissprotP0DH880.0BBRA_ORYSJ; Barley B recombinant-like protein A
SwissprotP0DH890.0BBRB_ORYSJ; Barley B recombinant-like protein B
TrEMBLA0A0D3HAK50.0A0A0D3HAK5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IP300.0A0A0E0IP30_ORYNI; Uncharacterized protein
STRINGBGIOSGA032378-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.33e-60basic pentacysteine 2