PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART09G10040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 258aa    MW: 28005 Da    PI: 7.3029
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART09G10040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1164.7e-3676156383
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                       ++drhski T++g RdRR+Rls+++a+ fF+Lqd+LGfdk+skt++WLl+q+kpai+ l+ ++sss++++  +++ ssa+
  OBART09G10040.1  76 FRTDRHSKIRTAQGVRDRRMRLSLDVARDFFALQDRLGFDKASKTVDWLLTQSKPAIDRLAADPSSSSHRAAGDTRMSSAE 156
                      689************************************************************888886663333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136934.92277135IPR017887Transcription factor TCP subgroup
PfamPF036348.4E-3477156IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MQQQLDQQQQ QQQQHQYDHF FSGHGQFNSE TLEAVLCRPP RGAAADPAVP AAAAAAVLTA  60
ARNGGGGHGR ARKRPFRTDR HSKIRTAQGV RDRRMRLSLD VARDFFALQD RLGFDKASKT  120
VDWLLTQSKP AIDRLAADPS SSSHRAAGDT RMSSAERGGD HHMVAVGAAG SGKGDADKAR  180
GPRGGRSAPM ELGCELGRLV PAPVLGEYYY ELAEMMSNNI GGEGDDDGDY DDDGDFLDDS  240
GFLCHYRSKK KFSIKDIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611514.11e-127transcription factor TB1-like
TrEMBLA0A0D3H6S60.0A0A0D3H6S6_9ORYZ; Uncharacterized protein
STRINGOBART09G10040.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40523172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18550.28e-28TCP family protein