PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART09G07680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Trihelix
Protein Properties Length: 1361aa    MW: 153623 Da    PI: 5.8513
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART09G07680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix64.13.1e-2025108172
         trihelix   1 rWtkqevlaLiearremeerlr...rgk..........lkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrt 72 
                      rWt+qe+l+Lie++  +e r +   r +          + +++W++v++++r++g+er+  qC+++w+nl ++ykkik+g+ +r 
  OBART09G07680.1  25 RWTRQEILVLIEGKHAVEGRGSgmgR-AaaasygeaaaALETKWASVAEFCRRHGVERGTAQCRKRWSNLPRDYKKIKDGSAGRG 108
                      8**************99999884332.03455555655889**************************************998874 PP

2trihelix47.54.8e-151562152486
         trihelix  24 gklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      +++ +++W++v++++r++g+er+  qC+++w+nl+++y ki+++e++ + +     p f +++
  OBART09G07680.1 156 AAALETKWASVAEFCRRHGVERGTAQCRKRWSNLARDYNKIERWERGAAGGW---EPSFWDMH 215
                      446689****************************************864333...36666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.3E-925108No hitNo description
Gene3DG3DSA:1.10.10.609.3E-42593IPR009057Homeodomain-like
PROSITE profilePS500906.042594IPR017877Myb-like domain
PROSITE profilePS500905.355152190IPR017877Myb-like domain
PfamPF138372.9E-8161215No hitNo description
SuperFamilySSF525409.69E-52532825IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009317.7E-48581853IPR002182NB-ARC
Gene3DG3DSA:3.40.50.3005.8E-9582741IPR027417P-loop containing nucleoside triphosphate hydrolase
PRINTSPR003641.6E-11585600No hitNo description
PRINTSPR003641.6E-11660674No hitNo description
PRINTSPR003641.6E-11761775No hitNo description
SuperFamilySSF520581.16E-348821061IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.109.9E-179021042IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520581.16E-3411381347IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.103.3E-1411521348IPR032675Leucine-rich repeat domain, L domain-like
PRINTSPR003641.6E-1112091225No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0043531Molecular FunctionADP binding
Sequence ? help Back to Top
Protein Sequence    Length: 1361 aa     Download sequence    Send to blast
MSGDPAGAAN AAAAASAAKP PRLPRWTRQE ILVLIEGKHA VEGRGSGMGR AAAASYGEAA  60
AALETKWASV AEFCRRHGVE RGTAQCRKRW SNLPRDYKKI KDGSAGRGGN DARRERRLPG  120
FFDREVYDIL DGRGRGTLGR GSGMGRAAAA SYGEAAAALE TKWASVAEFC RRHGVERGTA  180
QCRKRWSNLA RDYNKIERWE RGAAGGWEPS FWDMHNDARR EMRLPGFFDR EVYDILDSRR  240
LAFVNEMVFD SGRPVPEELM FSDDEEEEDD DEAPPVNPAG STVEEEEVED TEVFDSGRPA  300
AEESLFSDDE EEEAPPVTAA ASAAPAQAPH GQLIALPISE KSVASRQQRT EQRESFSSME  360
PLSYTTPEMK METDAVQLNC DWPMQTLQGH GSSEPSEKSA VQQSDDTNSR LHRDKQWRVQ  420
DKRLVLQRTL TEMHTFIKHA EWWFHKDVFA QLLQDAKDAV NCAEDLLDEI NYHEFQNKVE  480
GHAILFHVQD YHETKIDKIQ GKLEHLVRQM EQLGLYDERQ QFIIESISRE DNLFAEEQTI  540
FGRQKEMSEL IELIVLQENS PTDKQVTEVH AVPDCKRAKL ENVSVLPIVG SGGVGKTTLA  600
NLVFNERSVR DHFDLLIWIC VSDGFDEKKL MKRLAWSVAE SEMKTDDLGC LQRILTNGII  660
HHTRRLLLVL DDVQTDACRE DCHGWKIFLA PLKYARSGSM VLVTTRYQRV AERVGSLKHM  720
FLEGLPEETI WEFFRTLTFG SRNSNSNAVL EPIGRSIVAR LDGSSLGIKI IGRLLSLKLD  780
AKYWKIISES ELWGWPLQEE ASIFTALQLS YQYLPFHLKR CFSFCSLYPR GYEFDAETLV  840
DSWVAVGFVM PSRSILAVDI GHVYFNQLYV ARNDCFMIKS RSDMSRIPPK VRHVSILGNG  900
ELSSTDIECL NTYKTLRSIV CIGVGCDIIT NSVLETWFDH LTRIRMLRFI SCRLKELPCN  960
VGKLIHLRYL DISACDFDKL PTDLFCRLYK LEILDAQNCT LHAVPKDIIK LVNLQRLRLK  1020
NDLISQLGRV PEIGKLTLLQ NMPYYAVDDK PGRGIQELKN MNHLHGGLEI DGLRNVTSRE  1080
EAAGAELAKK IYLDTLVLKW YESIRPQKHN STKEMEVLEA LRPSSNIKHL EVKFYMGDGL  1140
SPMWLRHDEL SSLASFSINS CPNTTTLFLI EPSETGSSRS SSVSFQSLTK LSITWCRSLT  1200
SLDNFLQPEC LPMIKVIQIS NCEELASLPT NNLVHFVHLE DLEICHCWNL NWEPGLALPP  1260
SLKSLKLEAC GEFSDSTLSC LHNLTALTTL NLRFCPSIES ISAQIWSGLW SIESLKIVCC  1320
QGLVTVGGSE SIAGIKNVDI RHCSKLQDLE QPFRSGQADS Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0054220.0AP005422.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0441A12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612319.10.0PREDICTED: putative disease resistance protein RGA3 isoform X2
TrEMBLA0A0D3H6150.0A0A0D3H615_9ORYZ; Uncharacterized protein
STRINGORGLA09G0056300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1409969
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.16e-31Trihelix family protein