PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART09G04530.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 288aa    MW: 31369.6 Da    PI: 6.5197
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART09G04530.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29e-342377155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     ++rlrWt+eLHerFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  OBART09G04530.2 23 RQRLRWTNELHERFVEAVTQLGGPDRATPKGVLRIMGVQGLTIYHVKSHLQKYRL 77
                     58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7112080IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-322278IPR009057Homeodomain-like
SuperFamilySSF466894.66E-182277IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-262478IPR006447Myb domain, plants
PfamPF002493.9E-92576IPR001005SANT/Myb domain
PfamPF143796.1E-23110155IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MELGGNNMGS DNGANNNSNL AARQRLRWTN ELHERFVEAV TQLGGPDRAT PKGVLRIMGV  60
QGLTIYHVKS HLQKYRLAKY IPDSSADGNK AENKDPGDLL AGLEGSSGLQ ISEALKLQME  120
VQKRLHEQLE VQRQLQLRIE AQGKYLKKII EEQQRLGGVK SETPAAGASV TLPSDQFPDS  180
ERTDPSTPAP TSESPTQGVP SNRDNGGQNE ATKSPQRDDS LSRHEPLTPD SNCQPGSPTA  240
SPKHERAAKR QRGNGAEFSE TDFALPHSIF ESSSGSEFQQ CSMSYSGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-242380158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-242380158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-242380158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-242380158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1032410.0AK103241.1 Oryza sativa Japonica Group cDNA clone:J033123H06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611984.10.0myb family transcription factor PHL7 isoform X1
SwissprotQ9SJW01e-106PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A0D3H4X00.0A0A0D3H4X0_9ORYZ; Uncharacterized protein
TrEMBLI1QMS00.0I1QMS0_ORYGL; Uncharacterized protein
STRINGORGLA09G0034900.10.0(Oryza glaberrima)
STRINGOBART09G04530.20.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22203896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-81G2-like family protein