PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART08G15770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 369aa    MW: 39599 Da    PI: 6.7035
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART08G15770.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like31.15.2e-102346225
          G2-like  2 prlrWtpeLHerFveaveqLGGse 25
                     +rlrWt +LHerFv av++LGG++
  OBART08G15770.1 23 ARLRWTGQLHERFVLAVAELGGAD 46
                     7*********************97 PP

2G2-like37.64.8e-12761062151
          G2-like  21 LGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                      LG +  AtPk++l++m v+gLtl+h+kSHLQ
  OBART08G15770.1  76 LGAIAGATPKSVLRAMAVPGLTLYHLKSHLQ 106
                      888999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-222047IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-2282106IPR009057Homeodomain-like
PfamPF143799.6E-15215255IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MSSQQQQQHA GEAPASATAA ARARLRWTGQ LHERFVLAVA ELGGADSKPH PRAFLLLLPP  60
LTSLIMGMAD RSALFLGAIA GATPKSVLRA MAVPGLTLYH LKSHLQVRAC VRHAAGELSP  120
AADQLLANSV CIGSWFLTVL SSLPLLQKYR QAVSRGGNGG GGGSGSLNDR SSSSERQPAD  180
HDGDSAADEP RTIAYDGDSD GDAKEALRDS SRSMVQMQRE VQRKLQEQIE VQRHLQLRME  240
AQGRYLQSVL RRAQQVLADH SLASSPEAAT AELSELASAV DIECMSSSSP PRHHRQSATT  300
DSCVTTTSSS EAESKAAGSK RLHTSDCTVE QPVQGKRAFN FLQRHNQADQ EEEYAGAEDG  360
SSSEIDLNR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650853.11e-157myb-related protein 2
TrEMBLA0A0D3H0K70.0A0A0D3H0K7_9ORYZ; Uncharacterized protein
STRINGOBART08G15770.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112643038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.34e-29G2-like family protein