PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART08G15270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 299aa    MW: 30878.9 Da    PI: 6.5087
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART08G15270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.7e-32100153255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OBART08G15270.1 100 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 153
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.22E-1597154IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-2998154IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-24100153IPR006447Myb domain, plants
PfamPF002493.7E-7101152IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MASATSTTPD LSLHISLPSG GAAVGTTAPP GLGNGGAVGG AGGGKAAGGG DPWRRLDGST  60
ASTELSLSTP QQQQERSTSA ADVLPWRLRQ PTAAAAMRAP RMRWTSSLHA RFVHAVELLG  120
GHERATPKSV LELMDVKDLT LAHVKSHLQM YRTVKSTDKP AAASGPMDGS GSGSGSGDDE  180
LLAGDGRKAT SSGADADRRM SFTEHRSSSE GAASHAGGGG DGDCSSSAVN SDTIRARSNS  240
PRDLWLSSSV CNMDPQHLVT VEDMEPCRSS SLQVSSHELS SPSLEFTLGR PSWHSIDHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-17101155357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-17101155357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-17101155357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-17101155357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14249GGKAAGGG
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877880.0AK287788.1 Oryza sativa Japonica Group cDNA, clone: J065172N06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648273.11e-116probable transcription factor RL9
SwissprotQ0J2354e-73ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0D3H0F20.0A0A0D3H0F2_9ORYZ; Uncharacterized protein
STRINGOBART08G15270.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-31G2-like family protein