PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART08G11790.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 307aa    MW: 33379.1 Da    PI: 6.1825
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART08G11790.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.8e-334599155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     ++rlrWt+eLH+rFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  OBART08G11790.2 45 RQRLRWTNELHDRFVEAVTQLGGPDRATPKGVLRIMGVPGLTIYHVKSHLQKYRL 99
                     58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.75742102IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-3244100IPR009057Homeodomain-like
SuperFamilySSF466893.58E-184499IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-2646100IPR006447Myb domain, plants
PfamPF002498.1E-94798IPR001005SANT/Myb domain
PfamPF143791.5E-23131177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MYQPNPISSS GQTHGNPTAH EQMELGNNAI VPSNGGNNNP NMAARQRLRW TNELHDRFVE  60
AVTQLGGPDR ATPKGVLRIM GVPGLTIYHV KSHLQKYRLA KYIPDPSADD NKDEDKDPGN  120
LLSALEGSSG MQISEALKLQ MEVQKRLHEQ LEVQRQLQLR IEAQGKYLQK IIEEQQRVIG  180
AGASRATSSE QLPDSEKTNP PTPVPISESP VQGAPHSKNS QSQVEPTKSP SHDDALPCGE  240
PLTPDSSCRP GSPTLSPKHE RAAKRQRGSD AGDVTAFADG EFVLPPGIFE SSTGSEFQEC  300
SMPYSGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-2345102158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-2345102158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-2345102158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-2345102158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043960.0AP004396.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0404D10.
GenBankAP0044590.0AP004459.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0410E11.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648505.10.0myb family transcription factor PHL7
SwissprotQ9SJW05e-91PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A0D3GZB60.0A0A0D3GZB6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0QHS20.0A0A0E0QHS2_ORYRU; Uncharacterized protein
TrEMBLI1QHZ50.0I1QHZ5_ORYGL; Uncharacterized protein
TrEMBLQ84QT00.0Q84QT0_ORYSJ; Os08g0346500 protein
STRINGORUFI08G13040.20.0(Oryza rufipogon)
STRINGOS08T0346500-000.0(Oryza sativa)
STRINGORGLA08G0104600.10.0(Oryza glaberrima)
STRINGOBART08G11790.20.0(Oryza barthii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-77G2-like family protein