PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART08G11780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 244aa    MW: 26762.4 Da    PI: 8.4777
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART08G11780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-333286155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt +LH+rFv+av+qLGG++kAtPkti+++m+vkgLtl h+kSHLQkYRl
  OBART08G11780.1 32 KPRLRWTADLHDRFVDAVAQLGGPDKATPKTIMRTMGVKGLTLFHLKSHLQKYRL 86
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.9182989IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-322987IPR009057Homeodomain-like
SuperFamilySSF466891.16E-163288IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-243287IPR006447Myb domain, plants
PfamPF002493.6E-83485IPR001005SANT/Myb domain
PfamPF143795.8E-21127172IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MFPGLIHHHR LLDADGSGGG SSAGLVLTAD PKPRLRWTAD LHDRFVDAVA QLGGPDKATP  60
KTIMRTMGVK GLTLFHLKSH LQKYRLGKQS GKEMAEQSKD ASYLLGAQSG TNLSPTVPTP  120
DLKESQELKE ALRAQMEVQR KLHEQVEVQR HVQIRMEAYQ NYIDTLLEKA CNIVSEQLNG  180
FSISDHDLTS AGVMLSSSDT LSPSIFHQLS VSSISLHSPG GKSSPFAADA DLFFQKAPEK  240
RKSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-173288258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-173288258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-173288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-173288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-173288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-173288157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-173288258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-173288258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-173288258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-173288258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-173288258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-173288258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1038730.0AK103873.1 Oryza sativa Japonica Group cDNA clone:J033149L11, full insert sequence.
GenBankCT8342320.0CT834232.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN036L13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650961.11e-165protein PHR1-LIKE 3
SwissprotQ8LAJ72e-67PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A0D3GZB51e-179A0A0D3GZB5_9ORYZ; Uncharacterized protein
STRINGOBART08G11780.11e-180(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34273873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.14e-68G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]