PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART08G10570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 168aa    MW: 18911 Da    PI: 8.9102
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART08G10570.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.52.7e-14931404390
                      S-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
               B3  43 grsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                      g++We k+i++++  r +lt+GW +F+ +n+L++gD+++F+l+++++ 
  OBART08G10570.1  93 GNTWETKMIVSGNLTRWFLTGGWPKFACDNRLRAGDICLFELKEERRL 140
                      89***************************************9764443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.6E-1466146IPR015300DNA-binding pseudobarrel domain
CDDcd100175.22E-1369137No hitNo description
SMARTSM010190.001270148IPR003340B3 DNA binding domain
SuperFamilySSF1019367.98E-1474144IPR015300DNA-binding pseudobarrel domain
PfamPF023629.7E-1293142IPR003340B3 DNA binding domain
PROSITE profilePS5086311.60393148IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MICLSLTKGK LSAGGNGCSE NKKHGASNES LHNRKSNDSP YVLPHRSHLS PFQEKVVLEK  60
IEAIRCEVPI CVAIMKDYNV DYSSRKCCLL CMGNTWETKM IVSGNLTRWF LTGGWPKFAC  120
DNRLRAGDIC LFELKEERRL TMALTRNIGC RAKGPFNMVS ADCRKDYA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2370911e-149AC237091.1 Oryza glaberrima clone OG_BBa0009K13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D3GYY91e-122A0A0D3GYY9_9ORYZ; Uncharacterized protein
STRINGOBART08G10570.11e-123(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.11e-07ARF family protein