PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART08G03630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 189aa    MW: 20426.5 Da    PI: 6.1629
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART08G03630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.35.5e-31152455
          G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     +rWt++LH+rFv+ave LGG+++AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OBART08G03630.1  1 MRWTSTLHARFVHAVELLGGHDRATPKSVLELMDVKDLTLAHVKSHLQMYRT 52
                     79*************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-27153IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23152IPR006447Myb domain, plants
SuperFamilySSF466891.29E-14153IPR009057Homeodomain-like
PfamPF002498.2E-7151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MRWTSTLHAR FVHAVELLGG HDRATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKNTERPA  60
ASSDQADGFE NGSAGEICDE NSLDLHGGCR PEAMSAAATA AAARHGRLAA CNDHGSSTGA  120
HGALWNSSSR EDWSGFHESN TGTMQTLKDM QSKSLEILSD MNSCVSETTS STSELNLEFT  180
LGRPQNRPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16154558Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16154558Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16154457Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16154457Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16154457Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16154457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16154558Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0956891e-109FP095689.1 Phyllostachys edulis cDNA clone: bphylf026d19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648943.11e-130probable transcription factor RL9 isoform X1
SwissprotQ0J2352e-38ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0D3GWK61e-137A0A0D3GWK6_9ORYZ; Uncharacterized protein
TrEMBLI1QFV61e-135I1QFV6_ORYGL; Uncharacterized protein
STRINGORGLA08G0030700.11e-136(Oryza glaberrima)
STRINGOBART08G03630.11e-138(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47213665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-40G2-like family protein