PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G26710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 361aa    MW: 40056.7 Da    PI: 7.3749
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G26710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like962.7e-3052102151
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                      kprl+Wt+eLHerFveav+qLGG++kAtPkti++lm+++gLtl+h+kSHLQ
  OBART07G26710.1  52 KPRLKWTSELHERFVEAVNQLGGPDKATPKTIMRLMGIPGLTLYHLKSHLQ 102
                      79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.13649112IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.2E-2850102IPR009057Homeodomain-like
SuperFamilySSF466891.54E-1451103IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2152103IPR006447Myb domain, plants
PfamPF002492.6E-854102IPR001005SANT/Myb domain
PfamPF143791.4E-25170216IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MTGTEQMMYH QQQVQSDSQH LSSRPGLPPE KQFLLQGGAD SSSGLVLSTD AKPRLKWTSE  60
LHERFVEAVN QLGGPDKATP KTIMRLMGIP GLTLYHLKSH LQVSSIIRDL KIETKLASFI  120
KYRLSKNLQS QANASRAQGG CSTTEIDKPC EGNGSPASHL DLETQTNSSM HINEALQMQI  180
EVQRRLHEQL EVQRHLQLRI EAQGKYLQSV LEKAQEALGT IAVAETAATA NASSSKRLQN  240
EHTQLHHHQQ QQQVGDGSVD SCLTACDCEG SHHSRSHGHR GEQDILSIGL PPFEPAAARS  300
GKEHHYLLFP NEPSRRRSCS DERRREMSTL QASELDLSIN GRSSSHSHRR ENIDLNGAGW  360
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-1652102151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1652102151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1652102151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1652102151Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0676450.0AK067645.1 Oryza sativa Japonica Group cDNA clone:J013112H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646570.10.0myb-related protein 1 isoform X2
SwissprotQ9FK474e-77PHLA_ARATH; Myb-related protein 1
TrEMBLA0A0D3GV430.0A0A0D3GV43_9ORYZ; Uncharacterized protein
STRINGOBART07G26710.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35743879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-74G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]