PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G09860.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family EIL
Protein Properties Length: 465aa    MW: 50295.3 Da    PI: 8.7356
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G09860.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN347.93.4e-1591226130265
                      XX----STTS-HHHHHHHHHHHSSSSSS-TTS--T..TT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGH CS
             EIN3 130 sseshslselqDTtlgSLLsalmqhcdppqrrfpl..ekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmspti 221
                      ss    +s l D  l  + + lm+ c ppq  +pl  +  + pPWWPtG+e+ww+elg+ +    ppy+    l ka k  v  a +k + p++
  OBART07G09860.2  91 SSLAMAVSGLADHVLERMVKVLMRKCHPPQALYPLigKSPLRPPWWPTGREQWWPELGAGA--VVPPYRPAPLLSKAEKEVVVVAMVKNLVPDF 182
                      556666777888888888999*************95456799*************999764..468***999********************** PP

                      HHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX CS
             EIN3 222 eeirelerqskylqdkmsakesfallsvlnqeekecatvsahss 265
                      e++   +r   ++ ++++  e  a+   +  e++ +   ++h  
  OBART07G09860.2 183 ERLFMAVRMAPSVTSRITDAEARAWDDGVAGERETYMARHPHRT 226
                      *************************9999999888888888743 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.3180.101.7E-3989224IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048736.2E-1893209No hitNo description
SuperFamilySSF1167687.85E-4594219IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MDASKKSVMT KEEQQLSPAA SPAAAVMTAE ADAINEEQDK AAAATTADHT APPPPPPPAA  60
AVADHAVEMD MASGSGVAHL APPAVAPAPR SSLAMAVSGL ADHVLERMVK VLMRKCHPPQ  120
ALYPLIGKSP LRPPWWPTGR EQWWPELGAG AVVPPYRPAP LLSKAEKEVV VVAMVKNLVP  180
DFERLFMAVR MAPSVTSRIT DAEARAWDDG VAGERETYMA RHPHRTTPTR AWKLMDSLKP  240
EAVRMKLKAP KPKPQVTIKV EDAAPFLTVS AAADPAAVEA AMGAIEAMRN SSKDPDAPYY  300
PMPSPLHGHN EVGPNDYPEN PAIWKEFNRK EGQLDLLRVG KKNDRMAISD RVDGGASGSG  360
PRKGYLVMKT YKKAQEYYRE LRNKGAMASG AGVKIEDDSE TESDNEDEKA YEKAKAKAKA  420
RAVYQQNKGV KTEDQSETES DNKDEQAKVM AKAKGRVIPG PNKGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A4e-169520710121ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0051720.0AP005172.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBb0002J01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646400.10.0PREDICTED: uncharacterized protein LOC107276281
TrEMBLA0A0D3GPH90.0A0A0D3GPH9_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g17160.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.12e-14ETHYLENE-INSENSITIVE3-like 3