PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G02450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 917aa    MW: 102443 Da    PI: 10.3937
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G02450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.4e-08238330147
                      TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqky 47 
                      +++W+  E e+l++++kq   +                                              +W++Ia++   gR++ +c srw+++
  OBART07G02450.1 238 KQPWSDVEKEKLAKGIKQQYQEalilnsinngsstgdfsavdmayaltntagnfevtpeslrsvlpliNWNKIAAMYLPGRSGAECESRWLNF 330
                      79****************99999***************************************************99888************97 PP

2Myb_DNA-binding29.51.7e-09338382246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+ E+++l+  v+q G+++W  Ia t+g++Rt+ qc  r+q 
  OBART07G02450.1 338 NAWTAREEKRLILTVQQQGMNNWINIAVTLGTHRTPFQCLVRYQR 382
                      68**************************************99995 PP

3Myb_DNA-binding43.57.4e-14392435348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       W +eEd++l  av+ +G++ W ++++ m  gRt++qc +rw+k l
  OBART07G02450.1 392 DWAEEEDLQLQAAVNTFGTN-WQLVSASMD-GRTGNQCSNRWRKTL 435
                      6*****************99.*********.************975 PP

4Myb_DNA-binding51.13.1e-16443488248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+ +Ed++l  avk++G+g+W++Ia+ ++ gRt  qc +rw+++l
  OBART07G02450.1 443 GRWSLDEDKRLMVAVKLFGSGSWNKIAQFIP-GRTQSQCNERWRNVL 488
                      8******************************.************986 PP

5Myb_DNA-binding31.54.1e-10495539247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHH.HHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIa.rtmgkgRtlkqcksrwqky 47 
                      g W +eEd +l+  v ++G+  W++Ia ++++ +Rt+++c  rw+k+
  OBART07G02450.1 495 GEWRPEEDSILLASVDEFGPC-WSKIAgAKIP-HRTDNMCLRRWRKL 539
                      68*****************88.****945777.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051622.2E-9124IPR007836Ribosomal protein L41
PROSITE profilePS500906.4233331IPR017877Myb-like domain
SMARTSM007171.2E-5237333IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-7238270IPR009057Homeodomain-like
CDDcd001670.00163302330No hitNo description
Gene3DG3DSA:1.10.10.604.6E-7306351IPR009057Homeodomain-like
SuperFamilySSF466893.74E-5306345IPR009057Homeodomain-like
PROSITE profilePS5129410.749332388IPR017930Myb domain
SuperFamilySSF466891.58E-21336431IPR009057Homeodomain-like
SMARTSM007176.6E-4336386IPR001005SANT/Myb domain
PfamPF002496.6E-6338382IPR001005SANT/Myb domain
CDDcd001671.48E-4339384No hitNo description
Gene3DG3DSA:1.10.10.602.2E-10352395IPR009057Homeodomain-like
SMARTSM007171.2E-11389437IPR001005SANT/Myb domain
PfamPF002493.4E-12392434IPR001005SANT/Myb domain
PROSITE profilePS500909.721393435IPR017877Myb-like domain
CDDcd001672.92E-9393435No hitNo description
Gene3DG3DSA:1.10.10.602.5E-14396438IPR009057Homeodomain-like
PROSITE profilePS5129419.971436492IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-18439488IPR009057Homeodomain-like
SMARTSM007173.0E-12441490IPR001005SANT/Myb domain
SuperFamilySSF466895.64E-26441536IPR009057Homeodomain-like
PfamPF002492.7E-15443488IPR001005SANT/Myb domain
CDDcd001671.98E-11444488No hitNo description
Gene3DG3DSA:1.10.10.603.6E-15489544IPR009057Homeodomain-like
SMARTSM007171.9E-8493542IPR001005SANT/Myb domain
PROSITE profilePS5129413.267495544IPR017930Myb domain
PfamPF002493.1E-8495539IPR001005SANT/Myb domain
CDDcd001677.66E-9496539No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006412Biological Processtranslation
GO:0005840Cellular Componentribosome
GO:0003677Molecular FunctionDNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
Sequence ? help Back to Top
Protein Sequence    Length: 917 aa     Download sequence    Send to blast
MRAKWKKKRM RRLKRKRRKM RQRSNIRENL LLNKASPSSP LPRPICAWPP SDSEDDEDDL  60
ETLRAIQRRF SHYHSGTSSG SEMNTKTEAS KEGSGDIFGN ELDEEFDVEK HNKEATTRTG  120
FPKAALLLVD ALKKNRACQK FIRRKMITIE AKIEENKDLR DRVKCLLDYQ LSCRKAFGKI  180
LCQKEDPRVR LISSRKPCAQ STKNKDKKTP ALFLGPADNP HVSKYKMVLK QLPMSLQKQP  240
WSDVEKEKLA KGIKQQYQEA LILNSINNGS STGDFSAVDM AYALTNTAGN FEVTPESLRS  300
VLPLINWNKI AAMYLPGRSG AECESRWLNF DDPLINHNAW TAREEKRLIL TVQQQGMNNW  360
INIAVTLGTH RTPFQCLVRY QRSLNHCILN KDWAEEEDLQ LQAAVNTFGT NWQLVSASMD  420
GRTGNQCSNR WRKTLNPERS RVGRWSLDED KRLMVAVKLF GSGSWNKIAQ FIPGRTQSQC  480
NERWRNVLDP DIDLGEWRPE EDSILLASVD EFGPCWSKIA GAKIPHRTDN MCLRRWRKLC  540
QDKLPSVKAA QQIKKSILQC NFVDRETERP AIGPSDLMPL VRSKVDGSDE NTVSAKVRKP  600
RKRSRIPCED NVLPGDTSNS SPSMNLPLSE SIDAEAAVNT TTANSKKKPS RSRSKKQTDE  660
NLAVCDVNNS SNCSSGARKR KRSITDKNKV VQKKMISGDN EAVVETVGTI SADNEVATKR  720
KTSSTSVGEE GTTKKTTRGS LSGQGEVNKR MRGSISGVQK GATKQRMRGS VSTDNHGAVM  780
KSKRAPSRKS AKENSKADSM ANAAFGSDLP TVASEDRDAD NGNVKNGRLK SMPRPKQINM  840
TEGSADKFST STRLADCMSF GRINGSSRVA RHLCVSVKPL SNMIQSNGPS DVSAKDPTST  900
GTDPTSVENS NTALNLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-263095368155MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-263095368155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1516KKKRMRRLKRKR
2916MRRLKRKR
31018RRLKRKRRK
41219LKRKRRKM
51318KRKRRK
61420RKRRKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654520.0AK065452.1 Oryza sativa Japonica Group cDNA clone:J013025M19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647437.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647436.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647435.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647433.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647432.10.0PREDICTED: myb-like protein L isoform X1
TrEMBLA0A0D3GM350.0A0A0D3GM35_9ORYZ; Uncharacterized protein
STRINGORGLA07G0021600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-147myb domain protein 4r1