PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G01330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 355aa    MW: 38025.9 Da    PI: 7.4115
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G01330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.8e-32228283156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+p+LH++Fv a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  OBART07G01330.1 228 KTRRCWSPDLHRKFVAALQQLGGPQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 283
                      68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7225285IPR017930Myb domain
SuperFamilySSF466892.15E-16226285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-28226284IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-26228283IPR006447Myb domain, plants
PfamPF002497.2E-7230281IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MGLDVGEIGV GAADLSLDLK MFAAKSFGRV RGKDTTTTAM GDCIRRLEEE MGKIEVFRRE  60
LPLCVRLLAD VIDVMKEEVE KKGGDRKEDE EDAAGDKSNW MSTAQLWTGN SGGPDAAAAD  120
PVKQDKVRIS SEAKSNGGAF VGSGAPAFAR PKQSLMRKED MAYDVRMPDL SLLSPPASAA  180
AADESRRQVV GFAQAAARAA AMAASGPALS LQPQPQPAAA QQQQQARKTR RCWSPDLHRK  240
FVAALQQLGG PQVATPKQIR ELMKVDGLTN DEVKSHLQKY RLHNRPRVPS STIVNQPIVL  300
MQGLCYIPQE QSSSQSGSPE GPLHFSGSGM AGGGSSAATV SCEEEDGRSE SYGWK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0704210.0AK070421.1 Oryza sativa Japonica Group cDNA clone:J023048M12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644652.10.0myb family transcription factor EFM
TrEMBLA0A0D3GLN90.0A0A0D3GLN9_9ORYZ; Uncharacterized protein
TrEMBLI1NW840.0I1NW84_ORYGL; Uncharacterized protein
STRINGORGLA01G0412400.10.0(Oryza glaberrima)
STRINGORGLA07G0012100.10.0(Oryza glaberrima)
STRINGOBART07G01330.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-31G2-like family protein