PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART06G20690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 319aa    MW: 34740.5 Da    PI: 5.4256
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART06G20690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-3347101155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      ++rlrWt +LH+rFv+av+qLGG+++AtPk il++m+v+gLt++hvkSHLQkYRl
  OBART06G20690.1  47 RQRLRWTDDLHDRFVDAVTQLGGPDRATPKGILRIMGVQGLTIYHVKSHLQKYRL 101
                      58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.36744104IPR017930Myb domain
SuperFamilySSF466891.11E-1746101IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-3246102IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-2648102IPR006447Myb domain, plants
PfamPF002492.0E-849100IPR001005SANT/Myb domain
PfamPF143795.4E-12133169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MYEPKPFSSI VLAHNDPVSH NQQIERINNN VVSNSGGNSS NSNFAARQRL RWTDDLHDRF  60
VDAVTQLGGP DRATPKGILR IMGVQGLTIY HVKSHLQKYR LAKYIPDPTA DGAKSDKKDL  120
GDLLADIESS SGMEIGEALK LQMEVQRQLQ LRIEAQGRYL QKIIEEQQRL SGVLGESGKL  180
GALGPAPGEP YQDSNKTDPS TPVPTSESPI RDKAGSGLFK TISSHDDCRE PLTPDSSCRA  240
GSPLESPPRA SKRIRVSSDI DHRGNNEFPP PLKVPEPSSG SDFRQESSVL LSSSAVHFDS  300
LESLDADENV FTNGSGSDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-2447104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-2447104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-2447104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-2447104158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0326270.0FJ032627.1 Oryza glaberrima clone a0079B18 subtilisin-like protease precursor, ZAC, MYB-CC type transfactor, calcium ion binding protein, Monoculm1, Mlo family protein, aspartic proteinase nepenthesin-1 precursor, microtubule-associated protein MAP65-1a, IQ calmodulin-binding motif family protein, and EMB2261 putative genes, complete cds; and unknown genes.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644024.10.0myb family transcription factor PHL7
RefseqXP_015644025.10.0myb family transcription factor PHL7
RefseqXP_025881863.10.0myb family transcription factor PHL7
SwissprotQ9SJW08e-88PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A0D3GIK40.0A0A0D3GIK4_9ORYZ; Uncharacterized protein
TrEMBLA2YEX20.0A2YEX2_ORYSI; Uncharacterized protein
TrEMBLA3BDG60.0A3BDG6_ORYSJ; Uncharacterized protein
STRINGOBART06G20690.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22203896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.13e-88G2-like family protein