PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART06G17710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 538aa    MW: 57947.9 Da    PI: 6.5485
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART06G17710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31125178255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  OBART06G17710.1 125 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 178
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-29121179IPR009057Homeodomain-like
PROSITE profilePS5129412.601121181IPR017930Myb domain
SuperFamilySSF466895.38E-14124179IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-22125180IPR006447Myb domain, plants
PfamPF002499.4E-9126177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MGEVKEKEVV EIFEHDHDNK IRSPENSVPP AMVLDLNEGF GEGSEEGGVG EDGDEEDDDE  60
DDDDDDDGGS TSEVAGGGRS SSNNSSTNHN SGSDKDHDMN SSSSKADGGG DRVPTVRQYN  120
RSKLPRLRWT PDLHMAFVHA VERLGGQERA TPKLVLQMMN VRGLSIAHVK SHLQMYRSKK  180
LDHESGHERG AISSVFSPME FHMRRGDHRF HHHDMFFQRA AAAGVSPFSS RMLHENGGGF  240
FASRNPGLPE SSRLYGLFQR RQQAPMQKFD FKNCNSFSRN QEWAFNQQHA AARAAGAVNG  300
HGPAKGLIHE MIFRKEGKPT SHLFDVRDAI ASTRVTSATT AAAADHRLDG AGKAGNFDWI  360
GSSSSRPLTR TMSAATAATM GDHHHLRWRG GAAGSGNTTA SSDPVVASEA ALGSLLERAK  420
TKATEAMRLE TPVKMTAAAV AAEEINGRTP DLQLSLSPNA GDHRSAGKKR KFLSEQEVDS  480
DKQQLPLTLS LSLRGGGDNG GGEAAGRLEE EMTGSSSSKK AALGLSTLDL TMSIKALE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-18126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-18126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-18126180357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-18126180357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0736060.0AK073606.1 Oryza sativa Japonica Group cDNA clone:J033048N17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641453.10.0uncharacterized protein LOC4341235 isoform X1
TrEMBLA0A0D3GHK70.0A0A0D3GHK7_9ORYZ; Uncharacterized protein
STRINGOBART06G17710.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-34G2-like family protein