PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART06G01840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BBR-BPC
Protein Properties Length: 331aa    MW: 36626.3 Da    PI: 10.1229
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART06G01840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind405.85.5e-12413311301
        GAGA_bind   1 mdddgsre..rnkg.yye..........paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkl 81 
                      md+ g+re  r+++ +y+           +++lk++++++l++++++rd++irer++al+ekkaa+aerdmaf+qrd+a+aern+a+verdn+l
  OBART06G01840.1   1 MDNLGHREngRQRPdQYKglhtqwmmpqTQRHLKDHQSMNLLALMNDRDNAIRERDHALAEKKAAIAERDMAFTQRDAAMAERNAAVVERDNAL 94 
                      9999999999****9***********74449*************************************************************** PP

        GAGA_bind  82 lalllvensla...salpvgvqvlsgtksidslqqlse.....pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkak. 165
                      +al+l++++     + +++ +++lsg+k+i++++qls+      ql+ds+++ +re++++ea+pi++a+ +a ++k++kk++++++p+++ +  
  OBART06G01840.1  95 AALELARTNGLnmnNGNGFPQGSLSGSKNIHHHDQLSHaqsspLQLADSPYDhAREMHISEAYPISTAPGSAGKAKRPKKNSSQASPLKRPSGv 188
                      ***99888765566889999***************888899999********9*************************************9998 PP

        GAGA_bind 166 .kkkkksekskkkvkkesader......skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrg 252
                       +k+kk++ ++k+v ++++ ++      +k+e+k+++l+ln+v++Dest+P+P+CsCtG+lrqCYkWGnGGWqS+CCt++iS+yPLPv++++r+
  OBART06G01840.1 189 lRKTKKPSGDWKNVGMSGCGDDsahasvMKNEWKDQNLGLNQVAFDESTMPAPACSCTGKLRQCYKWGNGGWQSSCCTMNISMYPLPVMPNKRH 282
                      8888889**********99855589999****************************************************************** PP

        GAGA_bind 253 aRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      aR++grKmS+gaf+klL++LaaeG+dls+pvDLkdhWAkHGtn+++tir
  OBART06G01840.1 283 ARMGGRKMSGGAFTKLLSRLAAEGHDLSTPVDLKDHWAKHGTNRYITIR 331
                      ************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.4E-1821331IPR010409GAGA-binding transcriptional activator
PfamPF062171.2E-971331IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MDNLGHRENG RQRPDQYKGL HTQWMMPQTQ RHLKDHQSMN LLALMNDRDN AIRERDHALA  60
EKKAAIAERD MAFTQRDAAM AERNAAVVER DNALAALELA RTNGLNMNNG NGFPQGSLSG  120
SKNIHHHDQL SHAQSSPLQL ADSPYDHARE MHISEAYPIS TAPGSAGKAK RPKKNSSQAS  180
PLKRPSGVLR KTKKPSGDWK NVGMSGCGDD SAHASVMKNE WKDQNLGLNQ VAFDESTMPA  240
PACSCTGKLR QCYKWGNGGW QSSCCTMNIS MYPLPVMPNK RHARMGGRKM SGGAFTKLLS  300
RLAAEGHDLS TPVDLKDHWA KHGTNRYITI R
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0706160.0AK070616.1 Oryza sativa Japonica Group cDNA clone:J023060O20, full insert sequence.
GenBankAY9575050.0AY957505.1 Oryza sativa (japonica cultivar-group) barley B recombinant-like protein D mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641153.10.0barley B recombinant-like protein D
RefseqXP_015641154.10.0barley B recombinant-like protein D
SwissprotQ5VSA80.0BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBLA0A0D3GCC30.0A0A0D3GCC3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0A4I00.0A0A0E0A4I0_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HKD40.0A0A0E0HKD4_ORYNI; Uncharacterized protein
TrEMBLI1PZ790.0I1PZ79_ORYGL; Uncharacterized protein
STRINGOGLUM06G01860.10.0(Oryza glumipatula)
STRINGONIVA06G02210.10.0(Oryza nivara)
STRINGORGLA06G0019100.10.0(Oryza glaberrima)
STRINGOBART06G01840.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62263756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-101basic pentacysteine 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]