PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART06G00790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 259aa    MW: 28455.1 Da    PI: 11.0461
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART06G00790.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.92.6e-29178228252
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ 
  OBART06G00790.1 178 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQN 228
                      9*************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.73E-14175230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-26176232IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-21178231IPR006447Myb domain, plants
PfamPF002494.3E-7179229IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MELFPRQLDL SLHISTPSCF SPSPASASTT ASSWPWTTKQ QLPEEEEAAA TTSTTTSSRS  60
APPLLLCNSD VFSTRGSSTT NTNHHADGGL VNSQQLKAEA RQPIHGIPVY HGHQQQQRRQ  120
LHHPYDVVGT RQRDGGRRLF SHHVGVGVTP SRTLSSSSSS PARLLPRLPP GRRSVRAPRM  180
RWTTTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQNTK LSVDLETSML  240
RLPGRLNLEF TLGIGKASQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-13179230455Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-13179230455Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13179230354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13179230354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13179230354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13179230354Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-13179230455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-13179230455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-13179230455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-13179230455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-13179230455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-13179230455Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656560.16e-43PREDICTED: probable transcription factor KAN2
TrEMBLA0A0D3GC000.0A0A0D3GC00_9ORYZ; Uncharacterized protein
STRINGOBART06G00790.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP174351111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-29G2-like family protein