PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART05G22700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family VOZ
Protein Properties Length: 657aa    MW: 71588 Da    PI: 5.547
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART05G22700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ418.51.1e-1283245411217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                      p+ps++lgpkcalwdc rp++gs+++q+yc+ +ha laln+ gl+gt+pv+rp+gidlkdg+lfaalsakvqgk+vgip+cegaat+kspwna+
  OBART05G22700.1 324 PSPSQYLGPKCALWDCGRPVRGSDECQHYCNPYHAGLALNDdGLLGTRPVMRPRGIDLKDGPLFAALSAKVQGKNVGIPVCEGAATTKSPWNAP 417
                      89**************************************9799************************************************** PP

              VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                      elfdlsllege++rewlffd+prraf+sgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpss++ewhl+eye+n++dalalyrle+
  OBART05G22700.1 418 ELFDLSLLEGESLREWLFFDTPRRAFDSGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSNYEWHLFEYETNDSDALALYRLEY 511
                      ********************************************************************************************** PP

              VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                      k++d k+s+k+k+++++l+++q++++rl+a
  OBART05G22700.1 512 KSSDIKRSVKSKLASSPLSEIQQQMVRLSA 541
                      ****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MAGDPAAGGD GGRGSSGGKG SSRSSSRHQQ FRNLAKTRVD DLQEMFSGLQ SARKESRSAD  60
AALLEEQVHH MLREWRAELN VPSPASSLQA IPPNPSFPPS SFTCANSQSQ GNNREASDPP  120
SETLRLLQLA GAEEEDDATS KLVMPRSPMP MQSSHEGHNL SPVLQGGTMA GGAAELMVPR  180
SPLQQMPSSH QSHGHGQDGG QNLQGEAVMG STAATAAPHL GQGMQGDCGG MAGVTNAMFH  240
DQLYYIDHEL NIDDFLQDDD YKINLPGSNP DGPNTMQGIG QLEHQQYNLP LDLPPNSFVD  300
ANNSAQSSGD VFFHMSDLLT TMCPSPSQYL GPKCALWDCG RPVRGSDECQ HYCNPYHAGL  360
ALNDDGLLGT RPVMRPRGID LKDGPLFAAL SAKVQGKNVG IPVCEGAATT KSPWNAPELF  420
DLSLLEGESL REWLFFDTPR RAFDSGNRKQ RSLPDYNGRG WHESRKQVMK DFGGLKRSYY  480
MDPQPSSNYE WHLFEYETND SDALALYRLE YKSSDIKRSV KSKLASSPLS EIQQQMVRLS  540
ADSPVESKRT ARSRAKANQK DNNSNAYPAL NTPVQVSASN AHQTMSVNTP DQVNVSNAYQ  600
TMPLNTPNQP GPSNAYHAAS QMDQMTFLDG SVVYGPHLPY GYSTERSDFY WNPSDGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0690760.0AK069076.1 Oryza sativa Japonica Group cDNA clone:J023004H20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640409.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-115VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0D3G9S00.0A0A0D3G9S0_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g43950.10.0(Oryza sativa Japonica Group)
STRINGORGLA05G0199200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-111vascular plant one zinc finger protein