PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART05G22490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 233aa    MW: 24349.8 Da    PI: 10.0292
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART05G22490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP63.48.7e-205194346
              TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsk 46
                     g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk
  OBART05G22490.1 51 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSK 94
                     78*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136917.48652107IPR017887Transcription factor TCP subgroup
PfamPF036345.2E-185294IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MISNNSTNEE LGGGGRKAAD QPSGGAAAVA SSRHWSASTE SRIVRVSRVF GGKDRHSKVR  60
TVKGLRDRRV RLSVPTAIQL YDLQDRLGLS QPSKDGDKAA GGGGMKAFMS LSNSLGLLNA  120
ATMPATLAAH HHHHHHAAAY YAAAESWGNG GNGGHHHDVS HGVSPSAHNS PFPSLLSLAP  180
GSHHQFVFYS PEGGGFAVKE AAAEQFPVDS LDHSQGQLTL SSARSFLHSG SQG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1306040.0AC130604.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone B1155G07, complete sequence.
GenBankAK0699380.0AK069938.1 Oryza sativa Japonica Group cDNA clone:J023038I07, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankGQ2294840.0GQ229484.1 Oryza sativa Japonica Group TCP transcription factor (TCP11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637968.11e-112transcription factor TCP13
TrEMBLA0A0D3G9P71e-166A0A0D3G9P7_9ORYZ; Uncharacterized protein
STRINGOBART05G22490.11e-167(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-27TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5