PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART05G21200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 406aa    MW: 45602 Da    PI: 10.7004
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART05G21200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.2e-32194248155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+rlrWt++LH+rFv+a++qLGG+++AtPk +l +m+v+g+t++hvkSHLQkYRl
  OBART05G21200.1 194 KQRLRWTSDLHNRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRL 248
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.742191251IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-30192249IPR009057Homeodomain-like
SuperFamilySSF466892.15E-16193248IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-25194249IPR006447Myb domain, plants
PfamPF002495.2E-7196247IPR001005SANT/Myb domain
PfamPF143794.5E-24280326IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MGPTPWTRPT VHSSFPLPSR RRENPNQHNE TTRKRECEAK RAKKEREKKK SPPNPKASLS  60
SLSLALPSPR VAFAGHHRPR RFPLLSSPRV ASFLPFLTPP NSQLGIPLGR RRKRKQQRRA  120
SGSPALPAFW WWWRRPAADR CLAVPVSILM MYHAKKFSVP FGPQSTQSNE HMSNIGAFGG  180
SNMGSPANPA GSGKQRLRWT SDLHNRFVDA IAQLGGPDRA TPKGVLTVMG VPGITIYHVK  240
SHLQKYRLAK YIPESPAEGS KDEKKDSSDS LSNTDSAPGM QINEALKMQM EVQKRLHEQL  300
EVQRQLQLRI EAQGKYLQMI IEEQQKLSGS LKACEEQKLP HSPPSLDDYP DSMQPSPKKP  360
KMDNLSPDSV RDVTQSDFES HLIGPWDQEA AFRVDEFKAD PGLNKS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-21193251159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-21193251159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-21193251159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-21193251159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-21193251159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-21193251159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-21193251159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-21193251159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108115GRRRKRKQ
2108116GRRRKRKQQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0693060.0AK069306.1 Oryza sativa Japonica Group cDNA clone:J023012H08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639152.10.0myb family transcription factor PHL7
RefseqXP_015639153.10.0myb family transcription factor PHL7
RefseqXP_015639154.10.0myb family transcription factor PHL7
RefseqXP_015639155.10.0myb family transcription factor PHL7
TrEMBLA0A0D3G9990.0A0A0D3G999_9ORYZ; Uncharacterized protein
STRINGOBART05G21200.20.0(Oryza barthii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.17e-55G2-like family protein