PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART04G24010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 277aa    MW: 30660.9 Da    PI: 8.7606
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART04G24010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.19.3e-341973155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWtp+LHerFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  OBART04G24010.1 19 KPRLRWTPDLHERFVDAVTRLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 73
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-331675IPR009057Homeodomain-like
PROSITE profilePS5129412.5021676IPR017930Myb domain
TIGRFAMsTIGR015572.5E-241974IPR006447Myb domain, plants
SuperFamilySSF466891.7E-161975IPR009057Homeodomain-like
PfamPF002492.8E-92172IPR001005SANT/Myb domain
PfamPF143795.8E-21120164IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MFEGCYGGVG SAAATRDPKP RLRWTPDLHE RFVDAVTRLG GPDKATPKSV LRLMGMKGLT  60
LYHLKSHLQK YRLGRQSKKS AGLELAVADS GEFTAEGISF SIGAPPRNPA GGNNTGEIPL  120
ADALKYQVEV HRKLQEQLEV QKKLQMRIEA QGRYLKEILE KAQKNIPPDA NGSANLSSTR  180
SQITDINLAL SGFMDNATQV QEENNELMKP ISDDNLKVNN LGFQLYHLGS QESKDVKCTP  240
KTEELLLLDL NIQGGYELSS RGMQGCELDL KINQQRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-211975157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-211975157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-211975157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-211975157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1064000.0AK106400.1 Oryza sativa Japonica Group cDNA clone:002-102-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635409.10.0myb family transcription factor PHL11 isoform X2
TrEMBLA0A0D3FZR60.0A0A0D3FZR6_9ORYZ; Uncharacterized protein
STRINGOBART04G24010.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.15e-57G2-like family protein