PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART04G22740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 567aa    MW: 59492.3 Da    PI: 7.8518
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART04G22740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS161.76.1e-502625002253
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A a+++g++e a + L+ l+  a+++gd  qRl+a+++ AL++r+ +       + ++ +       e+ a  +l++++sP+++++ 
  OBART04G22740.1 262 RQLLSEAAAAIADGHNETAATHLTALKRAANSRGDVEQRLVAMMVAALSSRIGQ-------TASVPDI---CGGETRAGSQLLHDISPCFRLAL 345
                      689**************************************************9.......1111122...24455566789************ PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                       +aN aI++av  ++++H +Dfd+s + Q + L++ La+R+ +  sl++T+v +p+s  ++++ +t   L+k+Ae+ g++ +f++ v+ r  ++
  OBART04G22740.1 346 HAANVAIVDAVGDHRAIHLVDFDVSAP-QHADLIRCLAARRLPGTSLKVTAVTDPASPFTQSVTAT-LHLQKLAERAGIDYRFKM-VSCRAGEI 436
                      ************************987.99************************987666666555.57***************9.7999**** PP

             GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                      e ++L ++ gEalaVnl+++l +++desvs +++rde+L+ v+ l P+vv +veqe++ n++++
  OBART04G22740.1 437 EASKLGCEAGEALAVNLAFALSHVPDESVSPANPRDEILRRVRALGPQVVALVEQELNSNTAPL 500
                      ************************************************************9876 PP

2GRAS49.11e-15501567307374
             GRAS 307 erhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      er+e ++kWr+r+++aGF+pv+l+  +a+q+ +    v+  g+ v+ e+g l lgW++r ++++SaWr
  OBART04G22740.1 501 ERCEVFGKWRSRFGMAGFRPVALGPGIADQVLARQGPVA-AGFAVKAENGVLRLGWMGRVVTVASAWR 567
                      8*****************************977777777.99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098528.042235567IPR005202Transcription factor GRAS
PfamPF035142.1E-47262500IPR005202Transcription factor GRAS
PfamPF035143.5E-13501567IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYLYGVGS AVQMPMQQRS DAAAAGGVLK RSLGDMERWQ QHQHQQRQIA  60
MQQQLYLRTV RQRTAAASAA VSPLTSADIA AVLGGPPSQP LVLSGSSMGG AFGSPSSTLS  120
SITTASRAVA MPLMQPQLQR QQQVTYMASS PQVQAFGTAR ALPPAPATSD LSILQELEKQ  180
LLGDDDEVEA AMSGTGSAVT GSEWEEQLNS ITAAPSPPLT AATTPNNNNN AVGMTRSPSN  240
SSTSTASSSA SCSPPTSATT SRQLLSEAAA AIADGHNETA ATHLTALKRA ANSRGDVEQR  300
LVAMMVAALS SRIGQTASVP DICGGETRAG SQLLHDISPC FRLALHAANV AIVDAVGDHR  360
AIHLVDFDVS APQHADLIRC LAARRLPGTS LKVTAVTDPA SPFTQSVTAT LHLQKLAERA  420
GIDYRFKMVS CRAGEIEASK LGCEAGEALA VNLAFALSHV PDESVSPANP RDEILRRVRA  480
LGPQVVALVE QELNSNTAPL ERCEVFGKWR SRFGMAGFRP VALGPGIADQ VLARQGPVAA  540
GFAVKAENGV LRLGWMGRVV TVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-152574981249GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6066880.0AL606688.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0064M23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637100.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0D3FZB30.0A0A0D3FZB3_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014504-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g49110.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0197700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.18e-70SCARECROW-like 8