PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART04G21930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 306aa    MW: 32743.4 Da    PI: 8.5463
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART04G21930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.21.2e-302376255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     prlrWt eLH +Fv+a+e LGG++kAtPk il+lm+vkgLt++hvkSHLQ+YR 
  OBART04G21930.1 23 PRLRWTGELHCSFVQAIEFLGGQDKATPKLILQLMGVKGLTISHVKSHLQMYRC 76
                     8****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-291977IPR009057Homeodomain-like
SuperFamilySSF466891.52E-152176IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-232376IPR006447Myb domain, plants
PfamPF002492.0E-62475IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGSGGGGCGR NGAVRQYIRS KVPRLRWTGE LHCSFVQAIE FLGGQDKATP KLILQLMGVK  60
GLTISHVKSH LQMYRCSRLG SHGTGRRSEM QPQLQRKHSC GADEQVPREF LCPPLKRTRM  120
GTEATYKGMQ GSQGISEMRT TGTQYCIDDY MQAMAMERRI KEEGLRWQRD AAAAAAADGG  180
AAASNLQTVG CSVQESDPFK IIKPEVHHLG PVLKLQCSKV ENSGFISSST GTAARDQPEP  240
PPLEKCSLSL SLGPDPKCMP AIASSPSESS CILSSSSRSF SDCSGNSGCL VAPGVNLELS  300
MSICGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-172478357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-172478357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-172478357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-172478357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1018490.0AK101849.1 Oryza sativa Japonica Group cDNA clone:J033069K05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634437.10.0putative Myb family transcription factor At1g14600
TrEMBLA0A0D3FZ140.0A0A0D3FZ14_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9ZPD70.0A0A0D9ZPD7_9ORYZ; Uncharacterized protein
TrEMBLI1PNX80.0I1PNX8_ORYGL; Uncharacterized protein
TrEMBLQ7XUI60.0Q7XUI6_ORYSJ; OSJNBa0005N02.4 protein
STRINGOGLUM04G21960.10.0(Oryza glumipatula)
STRINGOS04T0566600-010.0(Oryza sativa)
STRINGORGLA04G0189700.10.0(Oryza glaberrima)
STRINGOBART04G21930.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.16e-29G2-like family protein