PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART04G20290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Trihelix
Protein Properties Length: 677aa    MW: 74053.3 Da    PI: 7.4175
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART04G20290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix100.41.4e-3173157187
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                      rW+++e+laLi++r+em+ ++r++ lk+plWeevs+k++e g++rs+k+Ckek+en++k+yk++keg+ +r++++s  +++f++lea
  OBART04G20290.1  73 RWPREETLALIRIRSEMDATFRDATLKGPLWEEVSRKLAELGYKRSAKKCKEKFENVHKYYKRTKEGRAGRQDGKS--YRFFTELEA 157
                      8*********************************************************************866665..******985 PP

2trihelix1086.4e-34429513186
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      rW+k ev+aLi++r e++ r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+
  OBART04G20290.1 429 RWPKTEVQALIQLRMELDMRYQETGPKGPLWEEISSGMRRLGYNRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLD 513
                      8*********************************************************************8.99**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.18966130IPR017877Myb-like domain
SMARTSM007172.1E-470132IPR001005SANT/Myb domain
CDDcd122033.12E-2972137No hitNo description
PfamPF138373.0E-2272158No hitNo description
PROSITE profilePS500907.805422486IPR017877Myb-like domain
SMARTSM007178.3E-6426488IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-4428485IPR009057Homeodomain-like
PfamPF138376.0E-23428514No hitNo description
CDDcd122031.52E-28429493No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MLRRRPPLPM SSRPPPAALS QPPPPQQQQQ PRTSYDELAA ATSAGAGGFP DDDMLGDAGG  60
SGGGGGSGAA GNRWPREETL ALIRIRSEMD ATFRDATLKG PLWEEVSRKL AELGYKRSAK  120
KCKEKFENVH KYYKRTKEGR AGRQDGKSYR FFTELEALHA AAPQTPQPQQ QQQQQLPPVT  180
SSAPAMHAFA PPPPINLQGL SFSSMSGSES DDESEDDEMT AETGGSQDRL GKRKRGAGGK  240
RLATFFEGLI KQVVDRQEEM QRRFLETMEK REAERTAREE AWRRQEVARL NREQEQLAQE  300
RAAAASRDAA IISFLQRIGG QSVQVPPAAT VIQMPTPVQL QTPPPVKQPA RQHQPQPTPP  360
PPQAAPIPAA PLQQQPPQPQ HKETIHHEAV TPRSAPPTSG SSLELVPAAE QHVESGLGGG  420
EGGSASSSRW PKTEVQALIQ LRMELDMRYQ ETGPKGPLWE EISSGMRRLG YNRSSKRCKE  480
KWENINKYFK KVKESNKKRP EDSKTCPYFH QLDVIYRRKH LTGGGGGGAS AANVAATAIE  540
HQNPNRHEIE GKNINDNDKR KNGGGGGAQV PTSNGDTAPT TATFDVNSGM KKPEDIVREL  600
SEQPPREFTT DETDSDDMGD DYTDDGEEGE DDGKMQYRIQ FQRPNPGGAN TAPPPATTPA  660
SAVPTSTPTS TFLAMVQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123KRSAKKCKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071390.0AK107139.1 Oryza sativa Japonica Group cDNA clone:002-124-D01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637050.10.0PREDICTED: trihelix transcription factor GTL1 isoform X1
TrEMBLA0A0D3FYH00.0A0A0D3FYH0_9ORYZ; Uncharacterized protein
STRINGOB04G27270.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.14e-48Trihelix family protein