PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART04G13800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 178aa    MW: 20591.8 Da    PI: 8.215
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART04G13800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.72e-251058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi+fs++gk+ye +
  OBART04G13800.1 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVIVFSPHGKIYELA 58
                     8*********************************************965 PP

2K-box57.65.4e-2080172596
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                      + +s+e++  +  qq++  L++e++ Lq+++R + Ge d++ ++l eLq+Le++Le  +++iRs+K++++ ++ie l++ke  l+ +n  L++
  OBART04G13800.1  80 QAESNEQNIPQVIQQDVLLLRQEVDLLQNSLRYMYGErDISHMNLGELQSLESNLEVWVNNIRSTKMQIMSREIEMLKNKEGILKAANDILQE 172
                      4555677778999***********************978*************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.22E-28177IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.24161IPR002100Transcription factor, MADS-box
CDDcd002654.61E-38275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-263859IPR002100Transcription factor, MADS-box
PfamPF014864.5E-2383173IPR002487Transcription factor, K-box
PROSITE profilePS5129713.16889178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCD ADIGVIVFSP HGKIYELATN  60
GNMQGLIERY KNKSNLPEAQ AESNEQNIPQ VIQQDVLLLR QEVDLLQNSL RYMYGERDIS  120
HMNLGELQSL ESNLEVWVNN IRSTKMQIMS REIEMLKNKE GILKAANDIL QERELVQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A9e-16184183MEF2 CHIMERA
6byy_B9e-16184183MEF2 CHIMERA
6byy_C9e-16184183MEF2 CHIMERA
6byy_D9e-16184183MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194477.11e-104MADS-box transcription factor 26-like
RefseqXP_020194478.11e-104MADS-box transcription factor 26-like
SwissprotA2YQK95e-73MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G85e-73MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0D3FW931e-127A0A0D3FW93_9ORYZ; Uncharacterized protein
STRINGOBART04G13800.11e-128(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-57AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]