PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G35350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 386aa    MW: 39697.7 Da    PI: 6.9226
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G35350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32121174255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OBART03G35350.1 121 PRMRWTTALHARFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 174
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.35E-16118175IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28119175IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23121174IPR006447Myb domain, plants
PfamPF002496.0E-8122173IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MLQRNLPNLS LRISPPAVSS AAAPVSSGTP TTAARTTLPT GVITDAEGGG EVAAFFGNPS  60
SGSEPPGLSL GLGPTTPAHA DAGGGRHGDH HLQPQGCAPF KRAAARASQL PAGSKRSVRA  120
PRMRWTTALH ARFVHAVELL GGHERATPKS VLELMNVKDL TLAHVKSHLQ MYRTVKSTDR  180
SSHIASGEAQ LQQQAGMEAA AGGGGDGGGG GVVLPMMPAC DDMVGICSSP APPAAATSSA  240
AAYFLCATTT STATAPLAVV PSPPAPTIPT RRTDQTPVLE KGVAIVDSLH RCQKHNYSPV  300
LQDALHQGAE EDHLITGNLP MGGASAQASI EAMATTNSSS PASSSPSLAS LEQLLPEDSF  360
APNLEISLGR QNWNMDHPEE LSLKYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-16122176357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16122176357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16122176357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16122176357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084080.0AK108408.1 Oryza sativa Japonica Group cDNA clone:002-142-G11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629095.10.0transcription factor LUX
TrEMBLA0A0D3FPH50.0A0A0D3FPH5_9ORYZ; Uncharacterized protein
TrEMBLI1PFU50.0I1PFU5_ORYGL; Uncharacterized protein
STRINGORGLA03G0324100.10.0(Oryza glaberrima)
STRINGOBART03G35350.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65543750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.27e-39G2-like family protein