PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G35220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 348aa    MW: 37328 Da    PI: 7.506
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G35220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32224279156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k r++W+peLH++Fv a++qLGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  OBART03G35220.1 224 KSRRCWSPELHRQFVAALQQLGGPQVATPKQIREVMKVDGLTNDEVKSHLQKYRLH 279
                      68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.681221281IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-28222282IPR009057Homeodomain-like
SuperFamilySSF466895.82E-17222282IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-26224279IPR006447Myb domain, plants
PfamPF002495.9E-7226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGLDVGEIGM GLDLSLDLKM FAARSAVRMA AAAAKEATGV EACIRSLEEE RRKIEMFRRE  60
LPLCARLLAD VIELMKEEAG KRRKDGDDAE AKAEDGDKTK WMSTAQLWVD SRGSDADSEN  120
DRRSGSTSPA SRLLGGAEES SSRAVAPPPY FRREERVVLR PAMPLLPPAS HRSPPPAAAA  180
AATAAGDDHR HVVASSFATA VPSPVPAALS LQAQAQQQQQ QARKSRRCWS PELHRQFVAA  240
LQQLGGPQVA TPKQIREVMK VDGLTNDEVK SHLQKYRLHN RKSPGTASAS HSIVLVGDLW  300
ASQEVSCSQS GSPQGPLQLS GSGVVVSAAT AGDSCCEDDD KSEGYVRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-13224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-13224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-13224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-13224277154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1056250.0AK105625.1 Oryza sativa Japonica Group cDNA clone:001-200-C11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631206.10.0transcription factor HHO5
TrEMBLA0A0D3FPG00.0A0A0D3FPG0_9ORYZ; Uncharacterized protein
STRINGOBART03G35220.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-41G2-like family protein