PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G26440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 211aa    MW: 21898.7 Da    PI: 9.3923
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G26440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like72.37.1e-23115159246
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                      pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  OBART03G26440.1 115 PRMRWTTALHAHFVQAVELLGGHERATPKSVLELMNVKDLTLAHM 159
                      9*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.48E-9112158IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-19112159IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-15115158IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MATTAATAPD LSLHISPPSP PDMAAGGETM EQLAEPKLCL GFGTAAAAAA EQYNNGGCNL  60
QQQQRLHQPS QIQRFKKSAS GGSPVCSGGA TGTGGVAAAR SGNGGGGGKR SSRAPRMRWT  120
TALHAHFVQA VELLGGHERA TPKSVLELMN VKDLTLAHMY RTVKGTTDRT CAEGHGQMRD  180
MGFLRRGGGG VDGFDVLGNT SSIAIANIRW E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0927800.0AC092780.6 Oryza sativa chromosome 3 BAC OSJNBb0079B16 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629914.11e-109uncharacterized protein LOC9269134 isoform X1
TrEMBLA0A0D3FLE31e-153A0A0D3FLE3_9ORYZ; Uncharacterized protein
STRINGOBART03G26440.11e-154(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.22e-26G2-like family protein