PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G26230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 1594aa    MW: 180247 Da    PI: 9.9716
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G26230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.47.1e-15361171198
                      HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       +++ +++p kf++++gg+   s t++l++++g  + v++  +k+++++vl+ GW+ Fv+a++++e+D+++F+++++s+f   v +f+
  OBART03G26230.1  36 DSRRSMIMPCKFVNHFGGD--FSGTIKLQSPNGILYVVEV--TKCKNKTVLRCGWEAFVDAHHIEENDSLLFRRVENSRF--EVLIFD 117
                      45566999*****888999..7779***************..*******************************8888888..888887 PP

2B339.51e-122273081898
                      --HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS..SEE..EEEEE- CS
               B3  18 lpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr..sefelvvkvfr 98 
                      ++  +ae h   +++s+t+tl+   ++++W  ++  rk  ++ +l++ W eFvk+n+++e D++vF  +++  ++f+++v+++r
  OBART03G26230.1 227 ISFCYAEVHF--PHKSVTVTLQRpCKSKKWHPRFYKRKDARMNILRGSWVEFVKDNRVQEQDICVFVPTKDarRNFTFTVHLLR 308
                      3333344443..56899******5677*******77888889*************************66442577878887776 PP

3B344.82.3e-144194941088
                      HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      + ++++l l  +fa++  ++ ++  + ++ +++g++W   +++r + +r ++ +GW +Fv++n+L++gD+++F+++ ++
  OBART03G26230.1 419 SASRCQLELGARFAAAVHLPDRR--QTVVLQRRGERWATVMQIRSGTRRLLI-SGWHRFVRDNRLRVGDICLFEFKTHE 494
                      345599********999888655..3666778*********88888877655.5********************87544 PP

4B344.33.2e-147418201297
                      HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      + + +++p +f++++ggk   + t++le+++g  + v++  + + ++++l+ GW+ Fv+a+++keg++++F+++++s+    v ++
  OBART03G26230.1 741 SMHSMIMPDRFVSHFGGK--IPGTIKLESPNGILYVVEV--TECMNKTLLQCGWEAFVDAHNIKEGESLLFRHIENSRY--EVLIL 820
                      456799******888888..5669***************..*******************************9986655..66665 PP

5B339.41.1e-1295010311697
                       EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE CS
               B3   16 lvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvf 97  
                       lv++ ++a+ h   ++e+ t+tl+ +s  ++W  ++  r  ++ ++l++ W++Fv++n L+e D+++F  ++  ++f ++v+++
  OBART03G26230.1  950 LVISSRYASVHF--PRETATITLQRPSKrKKWYPRFYKRIDKSDHMLRGQWQNFVHDNCLQEEDICLFVPTKGgRNFVFTVHLL 1031
                       799999999997..456779*****66659******66777777*************************776557887777766 PP

6B347.14.3e-15114812311698
                       EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE.....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
               B3   16 lvlpkkfaeeh.ggkkeesktltledesgrsWevkliy...rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98  
                       l l+ ++a+++   +k +++tl+l + +g  W+++l +     k++r +lt+GW++F+++n+L++gDf++F+l+++++ ++ v++++
  OBART03G26230.1 1148 LELSSRYAASYlP-DK-NHQTLVL-QCKGMIWQINLVVlrrYTKGKRWFLTAGWRKFAHDNRLRVGDFCLFELKKKKKLTMEVHIIS 1231
                       6788899999952.33.3346665.569******996675534444578************************999*******9986 PP

7B3521.2e-16127113521097
                       HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3   10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97  
                       + + + +++p +f++++ggk   + t++le+++g  + v++  + + +++v++ GW+ Fv+a+++k+gD+++F+++++s+f   v+++
  OBART03G26230.1 1271 TDSMHSMIIPDRFVNHFGGK--IPGTIKLESPNGILYVVEV--TECMNKTVIQCGWEAFVDAHHIKVGDSLLFRHIENSCF--EVMIL 1352
                       4455679*******888888..5669***************..**************************************..66665 PP

8B3421.7e-13150515881496
                       T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE....EEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEE CS
               B3   14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr....yvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkv 96  
                       ++l l  ++a++  ++ ++  + ++ ++ g++W+  +  + ksgr     +l +GW++Fv++n+L++gD+++++l+++ s+ +++v+ 
  OBART03G26230.1 1505 CQLELGARYAAAVHLPDRR--QAVVLQRMGQRWDTVM--QTKSGRcttrRFLINGWRRFVRDNRLCVGDICLLELKKHeSKLTMTVHT 1588
                       7777778888888777555..5899999*********..555555224445557*********************9877888888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.61E-2322121IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.0E-1924120IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.19626119IPR003340B3 DNA binding domain
CDDcd100171.99E-1928117No hitNo description
SMARTSM010194.9E-1029119IPR003340B3 DNA binding domain
PfamPF023621.7E-1337117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-18201308IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-18202308IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0022209310IPR003340B3 DNA binding domain
CDDcd100171.07E-17209308No hitNo description
PROSITE profilePS5086310.701210310IPR003340B3 DNA binding domain
PfamPF023626.5E-11225308IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-19399501IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.27E-17400497IPR015300DNA-binding pseudobarrel domain
CDDcd100171.11E-14405490No hitNo description
PROSITE profilePS5086312.393410504IPR003340B3 DNA binding domain
SMARTSM010192.9E-4411504IPR003340B3 DNA binding domain
PfamPF023625.9E-12420494IPR003340B3 DNA binding domain
SuperFamilySSF1019361.51E-19727825IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.139730823IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-16731824IPR015300DNA-binding pseudobarrel domain
CDDcd100179.33E-16731821No hitNo description
SMARTSM010191.5E-7733823IPR003340B3 DNA binding domain
PfamPF023621.9E-12741819IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.4E-189271033IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.85E-189271031IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.5E-49341034IPR003340B3 DNA binding domain
CDDcd100176.31E-189341029No hitNo description
PROSITE profilePS5086310.259351034IPR003340B3 DNA binding domain
PfamPF023626.5E-119501031IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.1E-1711231230IPR015300DNA-binding pseudobarrel domain
CDDcd100179.54E-1511271231No hitNo description
SMARTSM010195.3E-811331233IPR003340B3 DNA binding domain
PROSITE profilePS5086311.91411331233IPR003340B3 DNA binding domain
SuperFamilySSF1019361.57E-1511441234IPR015300DNA-binding pseudobarrel domain
PfamPF023621.2E-1211481231IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-2212591357IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.4E-1912621357IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.47812621355IPR003340B3 DNA binding domain
CDDcd100173.02E-1812641353No hitNo description
SMARTSM010191.8E-1112651355IPR003340B3 DNA binding domain
PfamPF023623.2E-1512711352IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.8E-1614811587IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-1514821587IPR015300DNA-binding pseudobarrel domain
CDDcd100171.30E-1214871587No hitNo description
PROSITE profilePS5086310.17914921590IPR003340B3 DNA binding domain
SMARTSM010190.01114971593IPR003340B3 DNA binding domain
PfamPF023625.3E-1115051589IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1594 aa     Download sequence    Send to blast
MAGSGSCMKK SCVCCQKYLE HLDGKMNCFV RRMTADSRRS MIMPCKFVNH FGGDFSGTIK  60
LQSPNGILYV VEVTKCKNKT VLRCGWEAFV DAHHIEENDS LLFRRVENSR FEVLIFDSDD  120
CEKNHQRVKD LLEIKREASA IVEKQQTWHL LLRIQAREDS PSEHESVESG DLETSQEPYV  180
LSRRSYLSEF QKDKVDALIQ EIQPETTAFV AIMRKSNVQL PTPFLVISFC YAEVHFPHKS  240
VTVTLQRPCK SKKWHPRFYK RKDARMNILR GSWVEFVKDN RVQEQDICVF VPTKDARRNF  300
TFTVHLLRVA AAYSRGGTGV DRAGSSLGRT DVKSASEISI KEEPIDQEEN VSSRNRNGVS  360
DESEEDEDSE GPAHPPYIVP CKSRLSRLQK KIVEEKVRSI QSKFPVYVAI MKKSNVERSA  420
SRCQLELGAR FAAAVHLPDR RQTVVLQRRG ERWATVMQIR SGTRRLLISG WHRFVRDNRL  480
RVGDICLFEF KTHERWRLTM ATPNITTALA SLSPGAAREA TTRPPRLPHP YPLLRSASPS  540
PERPPAKPRG HKDGGGGVLL VSSRSGGLGS RPEWRRRCPP DPRRSGRIWR DGLAAGTGDG  600
GGRGELRRVV LWVMAAGMAT SLGWRWWRSR IRRRRTRIRR RRGGRRWPEH AGTPRLPLAS  660
SGTPLDVGRR WWRGRRPDLA PCPDLARPRV GTGWLESGRR AGGVNIAGNT HRKKSCACCK  720
EYLEHLGGKM RCFLRRMAAD SMHSMIMPDR FVSHFGGKIP GTIKLESPNG ILYVVEVTEC  780
MNKTLLQCGW EAFVDAHNIK EGESLLFRHI ENSRYEVLIL DSDDCEKVFS CAGTRNGSCV  840
QDKTVDPVDS SGSSSNDTTQ SSRSRNTENL TAMCSSSEKS GEDSPSGYEF HESVEPQTPS  900
GSDYVLSRRT YLSEAQKERV VAHIQDIQPE ITVFVAVMKK CNLQSPAPYL VISSRYASVH  960
FPRETATITL QRPSKRKKWY PRFYKRIDKS DHMLRGQWQN FVHDNCLQEE DICLFVPTKG  1020
GRNFVFTVHL LQAEATHSRD GTDVHKIGSS QNKRNSKMAS QVHIKEAPGG DVSSESNKHG  1080
VSHESLESED SDGPSEPPYI SSMRRRLSQL QKKTVEEKVR AIQSEIPICV ATISKLAGSG  1140
GKGKFRGLEL SSRYAASYLP DKNHQTLVLQ CKGMIWQINL VVLRRYTKGK RWFLTAGWRK  1200
FAHDNRLRVG DFCLFELKKK KKLTMEVHII SNLQLHMAGG GSRMKKSCAC CKRYLEHLGG  1260
KMSCFLIRMT TDSMHSMIIP DRFVNHFGGK IPGTIKLESP NGILYVVEVT ECMNKTVIQC  1320
GWEAFVDAHH IKVGDSLLFR HIENSCFEVM ILDSDGCERV FSCAGIKTSS SCVHDKTVDP  1380
VDTSGRSSDD TAQPSRSERF ARCQRDTSND RRNTASLTAV SSSSEESENV SLKSNRNGVS  1440
DESQESEDSE GPAGPPYILS WKSKSRLSSL QKKIIKEKVR SIQSEVPIYV AIMNKSNIGL  1500
TSSPCQLELG ARYAAAVHLP DRRQAVVLQR MGQRWDTVMQ TKSGRCTTRR FLINGWRRFV  1560
RDNRLCVGDI CLLELKKHES KLTMTVHTIF SQQS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1629636RIRRRRTR
212161222LKKKKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1193990.0AK119399.1 Oryza sativa Japonica Group cDNA clone:001-132-D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629380.10.0B3 domain-containing protein Os03g0619800
RefseqXP_015629381.10.0B3 domain-containing protein Os03g0619800
SwissprotQ6AV210.0Y3982_ORYSJ; B3 domain-containing protein Os03g0619800
TrEMBLA0A0D3FLB90.0A0A0D3FLB9_9ORYZ; Uncharacterized protein
STRINGOBART03G26230.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.19e-18B3 family protein