PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G15810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 355aa    MW: 39502.7 Da    PI: 7.8718
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G15810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.71.5e-3447101155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprl+WtpeLHerFveav+qLGG+ekAtPkti++lm+v+gLtl+h+kSHLQkYRl
  OBART03G15810.1  47 KPRLKWTPELHERFVEAVNQLGGPEKATPKTIMRLMGVPGLTLYHLKSHLQKYRL 101
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.87444104IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-3345102IPR009057Homeodomain-like
SuperFamilySSF466896.45E-1846102IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-2447102IPR006447Myb domain, plants
PfamPF002499.1E-1149100IPR001005SANT/Myb domain
PfamPF143793.3E-25149195IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MYHHQQQLQS HNQLLPSRQS FPSERHLLMQ GGSVSGESGL VLSTDAKPRL KWTPELHERF  60
VEAVNQLGGP EKATPKTIMR LMGVPGLTLY HLKSHLQKYR LSKNLHAQAN AGNVKNALVC  120
TTATEKPSEA NGSPVSHLNL GTQTNKSVHI GEALQMQIEV QRRLHEQLEV QRHLQLRIEA  180
QGKYLQSVLE KAQETLAKQN AGSVGLETAK MELSELVSKV STECLQHAFS GFEEIESSQM  240
LQGHTMHLGD GSVDSCLTAC DGSQKDQDIL SISLSAQKGK EIGCMSFDMH VKERGSEDLF  300
LNKLNRRPSN HPERCQRRGG FSMSCQTANL DLNMNDTYDG PKHCKKFDLN GFSWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2146103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2146103158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-2147103157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2147103157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2147103157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2147103157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2146103158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2146103158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2146103158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2146103158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2146103158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2146103158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1002820.0AK100282.1 Oryza sativa Japonica Group cDNA clone:J023074M06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627784.10.0myb-related protein 2 isoform X1
SwissprotQ9FK471e-103PHLA_ARATH; Myb-related protein 1
SwissprotQ9SQQ91e-103PHL9_ARATH; Myb-related protein 2
TrEMBLA0A0D3FHY80.0A0A0D3FHY8_9ORYZ; Uncharacterized protein
TrEMBLI1PAW80.0I1PAW8_ORYGL; Uncharacterized protein
STRINGORGLA03G0151400.10.0(Oryza glaberrima)
STRINGOBART03G15810.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35743879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.42e-95myb-related protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]