PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G06780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 130aa    MW: 14288.3 Da    PI: 11.1356
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G06780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP362.3e-1187130245
              TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkds 45 
                      a +k ++++ h+kv+  + R+R+ +  aa +F+L  eLG+++d+
  OBART03G06780.1  87 AIRKPPSKDCHSKVDALGCRIRMHIIYAAHIFQLNHELGHKSDG 130
                      689***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.4E-793130IPR005333Transcription factor, TCP
PROSITE profilePS513699.15493130IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MSPGRNEMKS TIVVRQGLRR FKTIRLHEVR EAGVGKALVQ WRRSGNRGRD GHCARVPRQL  60
HGDGGGGAAL DKQLVPDASN DNGTALAIRK PPSKDCHSKV DALGCRIRMH IIYAAHIFQL  120
NHELGHKSDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2104801e-153AC210480.2 Oryza glaberrima clone OG_BBa0067M08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629543.11e-22transcription factor TCP21
TrEMBLA0A0D3FEX12e-90A0A0D3FEX1_9ORYZ; Uncharacterized protein
STRINGOBART03G06780.13e-91(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3818033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.11e-16TCP family protein