PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G02540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 454aa    MW: 48538.6 Da    PI: 4.6898
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G02540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27180234156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k++++WtpeLH+rFv+aveqL G++kA+P++ile+m++++Lt+++++SHLQkYR++
  OBART03G02540.1 180 KAKVDWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGIDSLTRHNIASHLQKYRSH 234
                      6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.924177236IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-27178237IPR009057Homeodomain-like
SuperFamilySSF466896.54E-19178237IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-26180234IPR006447Myb domain, plants
PfamPF002496.2E-8183232IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MLAVSPAMCP DIEDRAAVAG DAGMEVVGMS SDDMDQFDFS VDDIDFGDFF LRLEDGDVLP  60
DLEVDPAEIF TDFEAIATSG GEGVQDQEVP TVELLAPADD VGVLDPCGDV VVGEENAAFA  120
GVGEEKGGCN QDDDAGEANA DDGAAAVEAK SSSPSSTTSS SQEAESRHKS SSKSSHGKKK  180
AKVDWTPELH RRFVQAVEQL GIDKAVPSRI LEIMGIDSLT RHNIASHLQK YRSHRKHMIA  240
REAEAASWTQ RRQIYAAGGG AVAKRPESNA WDVPTIGFPP PPPPPSPAPM QHFARPLHVW  300
GHPTMDPSRV PVWPPRHLVP RGPAPPWVPP PPPSDPAFWH HPYMRGSAHV PTQGTPCMAM  360
PMPAARFPAP PVPGVVPCPM YRPLTPPALA SKNQQDAQLQ LQVQPSSESI DAAIGDVLSK  420
PWLPLPLGLK PPSVDSVMRE LQRQGVANVP PACG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-17177232257ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional activator that promotes chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. {ECO:0000269|PubMed:19808806}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. {ECO:0000269|PubMed:11340194}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3185810.0AF318581.1 Oryza sativa putative transcription factor OsGLK1 (Glk1) mRNA, complete cds.
GenBankAK0619460.0AK061946.1 Oryza sativa Japonica Group cDNA clone:001-042-E04, full insert sequence.
GenBankAK0651840.0AK065184.1 Oryza sativa Japonica Group cDNA clone:J013002D22, full insert sequence.
GenBankAK0989090.0AK098909.1 Oryza sativa Japonica Group cDNA clone:J013002F22, full insert sequence.
GenBankAK1221610.0AK122161.1 Oryza sativa Japonica Group cDNA clone:J033147G01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644244.10.0probable transcription factor GLK1
SwissprotQ5Z5I40.0GLK1_ORYSJ; Probable transcription factor GLK1
TrEMBLA0A0D3FDF10.0A0A0D3FDF1_9ORYZ; Uncharacterized protein
STRINGOBART03G02540.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-53GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang Y, et al.
    A highly efficient rice green tissue protoplast system for transient gene expression and studying light/chloroplast-related processes.
    Plant Methods, 2011. 7(1): p. 30
    [PMID:21961694]