PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G02480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 850aa    MW: 94578.5 Da    PI: 6.1951
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G02480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.62.5e-28528578252
           RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ek++sl+dl+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  OBART03G02480.1 528 EKTVSLQDLRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 578
                      799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029517598IPR003035RWP-RK domain
PfamPF020426.1E-26530578IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2409.8E-26750834No hitNo description
SuperFamilySSF542779.08E-23750834No hitNo description
PROSITE profilePS5174523.255752835IPR000270PB1 domain
SMARTSM006662.0E-25752835IPR000270PB1 domain
PfamPF005641.0E-17753834IPR000270PB1 domain
CDDcd064073.02E-43753834No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 850 aa     Download sequence    Send to blast
MEQKPSPPPP PRSDEEEDGL MGCGMGGTGN IAGGDLDLME EFLLATPGLD LSEFWHPGAA  60
SPFSPLFDIG SSGRGGDAQP WRRLDRRNQR LASYRTVSMK YQFSADESAR ADLGLPGRVF  120
VGRVPEWTPD VRYFSTEEYP RVQHAQYFDI RGSVALPVFE PRSRACLGVV ELVMTTQKVN  180
YSAEIENICN ALKEVDLRSS DVSSDPRSKV VDASYRAIIP EIMDVLRAVC DTHNLPLAQT  240
WIPCICQAKR GSRHSDESYK HCVSTVDEAC YVRDRSVLGF HQACSEHHLF RGEGVVGRAF  300
GTNEPCFSPD ITTYSKTQYP LSHHAKLFGL RAAVAIRLRS VKTGSLDFVL EFFLPMKCIN  360
TEEQRAMLNS LSNTIQQVCY TLRVVKPKEL VNDGPLEISQ PTRPEFYAKS VHENLDELCS  420
GINVPGRTTS LEASEEVSSW IASLVDAQNK GGKGEIDVDL PFGFSKQDDE GFSVTAGWHT  480
SPVMAPDGSM FSGFKCHEDY DVKENTCSSD PSNSNSDKAV EKRRTKTEKT VSLQDLRKHF  540
AGSLKEAAKN LGVCPTTLKR ICRQHGINRW PSRKIKKVGH SLKKLQMVID SVHGPEGTVQ  600
LSSLYENFTK TTWSERELQG DVHFPASEQN FQLEPSVPDR PCEGRFTSHT SGSNSISPSC  660
SQSSNSSLGC SSVPKTQQQH GSAPQLAVKE EISMDENQCS TLIKSASHAE AELQMFVEER  720
PTMLFRSQSQ VLLSEHKPIE NLSNMQKARS DSLKIKAIYG EERCIFRLQP SWGFQRLKEE  780
IVKRFGISQD THVDLKYLDD ESEWVLLTCD ADLLECIDVY KSSSNQTVRI LVNPSIQPLL  840
NASFGQTGLS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000460.0AK100046.1 Oryza sativa Japonica Group cDNA clone:J013153P10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651009.20.0PREDICTED: protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A0D3FDE50.0A0A0D3FDE5_9ORYZ; Uncharacterized protein
STRINGOBART03G02480.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]