PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART03G01030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Trihelix
Protein Properties Length: 288aa    MW: 29579 Da    PI: 4.2701
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART03G01030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix74.22.1e-2362119158
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenln 58 
                      rW++qe+laL+++r+em+ ++r+++lk+plWeevs+k++e g++rs+k+C+ek+en+ 
  OBART03G01030.1  62 RWPRQETLALLKIRSEMDAAFREAALKGPLWEEVSRKLAEMGYNRSAKKCREKFENVD 119
                      8*******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.001659121IPR001005SANT/Myb domain
PfamPF138371.5E-1461119No hitNo description
CDDcd122037.14E-2861118No hitNo description
PROSITE profilePS500906.99261119IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MPPFSAAGSE GAPSPISSRP PPPEQAAAAA AAEEQLNGSS LEHDGVLGGE EGDRGGSPAG  60
NRWPRQETLA LLKIRSEMDA AFREAALKGP LWEEVSRKLA EMGYNRSAKK CREKFENVDN  120
NGNGNGWASA NNGGGGSSSG GMQTKASNNG TATAGGLPVV SVAGGNGNGV AATTDNKGSK  180
QVPVAKETAG QRQPQPLAMN HNYGNDRMAD DMDSDSMDDD DDDDEFDDDD DIGGGKMQVQ  240
YEIQRPQLQN QNVVVGRPNA SGGGAPTTPA GPPPPAATSG TSFLACVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2418000.0AK241800.1 Oryza sativa Japonica Group cDNA, clone: J065208I24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628078.18e-51PREDICTED: trihelix transcription factor GTL1
TrEMBLA0A0D3FCX50.0A0A0D3FCX5_9ORYZ; Uncharacterized protein
STRINGOB03G11000.13e-84(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP152231218
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-26Trihelix family protein