PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G37080.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 796aa    MW: 88372.1 Da    PI: 5.1081
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G37080.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.61.5e-24647691145
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                      kpr+rWtpeLHerFv+av++LGGsekAtPk++ ++mkv+gLt++h
  OBART02G37080.2 647 KPRMRWTPELHERFVDAVNKLGGSEKATPKAVQKVMKVDGLTIYH 691
                      79*****************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF111072.6E-461211No hitNo description
PfamPF111071.8E-18218347No hitNo description
SuperFamilySSF466893.23E-10644691IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-21646691IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-16647690IPR006447Myb domain, plants
PfamPF002493.3E-6649689IPR001005SANT/Myb domain
PfamPF143794.0E-18713755IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
MEELLGLVRG FVDVLVLAGG RTSSGAAATW RSGDVKKALQ WALFFEEVFK NLRDDGQYDE  60
SASELDAALV QLASSPNFPK GIEDIQSKTL AMARELVVKH FLKTTNAENL GAVLQAVVEM  120
DMDGISASGE CNVCQEYVQS ILDMNLPSLM RTKNARDVGH STSSDEFCEE SLFTGNSQIL  180
LKELQKKLDS RSCISLAERE LNTLLKSMKK DSFDSAGSTL CTSATAQKTQ IIDKFILWKQ  240
WKAKCLSYLL DERTIRIMSG TNMIFNAPKE QWMGLFEPLK VSADSSQSGI VEVMELCLLG  300
LVARQWNSLI ESIMSHTFSS FPISKQYADL HQLLQGTTQD ECQDKLLGFK EMDICEYARQ  360
SLESEPYILW LLPPVLTAAA MPPRSSLFKI YLVEIDKQLG EAASKDRPTS TMNQLRNGKV  420
PQYLSPAITV VPALSEVTFP SFSEHRPSYI EREQCGSSIN SFDASTPMCM LASNFTSDLY  480
INKSESPNGK LSSESYAIDT SGCDSSLPPT QSLYKGNPSS LRMVYPKVSE QNSWSQEPLP  540
GPFVCPTSVD FFDQQDMTIF DQQIQDNIAA SPSTNLAKQN EWFSSGTSLQ YLESSVSAGS  600
VLKAVDATST TPSNYLHCHA QRNTSNPPNF NEICSGNIAS SNIAPTKPRM RWTPELHERF  660
VDAVNKLGGS EKATPKAVQK VMKVDGLTIY HKYRTVHHRP QLSDGRGMET TCEGLRVQIG  720
LQKQLHEQLE IQRKLQLQVE EHSKYLAMII EKQSESLRQL GALPRSLDAP TQVLDNRETC  780
EGQTGDADSA EQKPEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-20647699260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-20647699260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-20647699260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-20647699260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-20647699260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-20647699260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-20647699260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-20647699260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0663820.0AK066382.1 Oryza sativa Japonica Group cDNA clone:J013064K05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627299.10.0uncharacterized protein LOC4331121
RefseqXP_015627301.10.0uncharacterized protein LOC4331121
RefseqXP_015627302.10.0uncharacterized protein LOC4331121
RefseqXP_025878774.10.0uncharacterized protein LOC4331121
RefseqXP_025878775.10.0uncharacterized protein LOC4331121
TrEMBLA0A0D3FBZ70.0A0A0D3FBZ7_9ORYZ; Uncharacterized protein
STRINGOBART02G37080.10.0(Oryza barthii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-38phosphate starvation response 1