PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART02G32460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 180aa    MW: 20051 Da    PI: 11.8186
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART02G32460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP67.25.5e-213393565
              TCP  5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65
                      d+hsk+ T++g+ dRR+Rls+++ + f+d+qd+LG+ ++sk ieWL+ +a  a   l   
  OBART02G32460.1 33 GDKHSKVVTSRGLHDRRIRLSVPTYIAFYDIQDRLGVNRPSKSIEWLICAALVARLLLHPP 93
                     59*********************************************98886665555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136923.2153290IPR017887Transcription factor TCP subgroup
PfamPF036341.5E-193483IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MEEVVVGKER KRPRCALVGV GGHGSDVADE PGGDKHSKVV TSRGLHDRRI RLSVPTYIAF  60
YDIQDRLGVN RPSKSIEWLI CAALVARLLL HPPQRRPAPH PRRPSSGRPS EEQARTRKAT  120
VGGVTWEGWG RRGGRRESGC AARKAERIAK LRVWREGWMP RREASTSAAS GGQSWIRKPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A5e-143780144Putative transcription factor PCF6
5zkt_B5e-143780144Putative transcription factor PCF6
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057330.0AP005733.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBb0024K03.
GenBankAP0058480.0AP005848.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0078N11.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619107.13e-30transcription factor PCF8-like
TrEMBLA0A0D3FAG81e-124A0A0D3FAG8_9ORYZ; Uncharacterized protein
STRINGOBART02G32460.11e-125(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1996588
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30210.22e-20TCP family protein